KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042680Help
Entry
101042680         CDS       T04350                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00140  Steroid hormone biosynthesis
sbq01100  Metabolic pathways
sbq04913  Ovarian steroidogenesis
sbq04925  Aldosterone synthesis and secretion
sbq04927  Cortisol synthesis and secretion
sbq04934  Cushing syndrome
Module
sbq_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
sbq_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101042680
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101042680
   04925 Aldosterone synthesis and secretion
    101042680
   04927 Cortisol synthesis and secretion
    101042680
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101042680
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     101042680
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     101042680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind KR NmrA Ldh_1_N adh_short
Motif
Other DBs
NCBI-GeneID: 101042680
NCBI-ProteinID: XP_010331248
UniProt: A0A2K6UJL5
Position
Unknown
AA seq 373 aa AA seqDB search
MTGWSCLVTGAGGFLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQSKTKLTMLE
GDILDESCLKRACQDITVVIHTASIIDVLGVIHRESIMNVNVKGTQLLLEACVHASVPVF
IYTSSVEVAGPNSYREVIQNGHEDQPLENTWSAPYPYSKQLAEKAVLAADGWTLKNGGTL
YTCALRPMYIYGEGSRFLSATINEALNNSGILPSIGKFSTVNPVYVGNVAWAHILALRAL
RDPKKAPSVRGQFYYISDDTPHQSYDGLDYSLSKEFGLRLDSSWSLPLLLMYWIGFLLEV
VSFLLSPIYTYRPPFNRHTVILSNGRYTFSYKKAQRDLAYKPLYSWEEARQKTAEWFGSL
VDRHKEMLKSKTQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacgggctggagctgccttgtgactggagctggagggtttctgggtcagaggatcgtc
cgcctgttggtggaggagaaagaactgaaggagatcagggccttggacaaggccttcaga
ccagaactgagggaggaattttctaagctccagagcaagaccaagctgacgatgctggaa
ggagacattctggatgagtcatgcctgaagagagcctgccaggacatcacggtcgtcatc
cacacggcctctatcattgatgtcttgggtgtcattcacagagagtctatcatgaacgtc
aacgtgaaaggtacccagctcctgttggaggcctgtgtccacgctagtgtgccagtcttc
atctacaccagcagcgtagaggtggctgggcccaactcctacagggaagtcatccagaac
ggccacgaagatcagcctctggaaaacacgtggtctgctccctatccatacagcaaacag
cttgctgagaaggctgtgctggcggctgatgggtggactctgaaaaatggtggcaccttg
tacacttgtgccttaagacccatgtatatctatggggaaggaagccgattcctttctgcc
actataaatgaggccctgaacaacagtggaatcctgccaagtatcggcaagttctccaca
gtcaacccagtgtatgttggcaatgtggcctgggcacacattctggccttgagggccctg
cgggaccccaagaaggccccaagtgtccgaggacagttctattacatctcagacgacacg
cctcaccaaagctatgatggccttgattacagcctgagcaaagagttcggcctccgtctt
gattccagttggagccttcctttactcctgatgtactggattggcttcctgctggaagtg
gtgagcttcctgctcagcccaatttacacctatcgaccccccttcaaccgccacacagtg
atcttgtcaaatggcaggtacaccttctcttacaagaaggctcagcgagatctggcatat
aagccgctctacagctgggaggaagccaggcagaaaaccgcggagtggtttggttccctt
gtggaccggcacaaggagatgctgaagtccaagactcagtga

DBGET integrated database retrieval system