KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043632Help
Entry
101043632         CDS       T04350                                 

Gene name
THUMPD2
Definition
(RefSeq) THUMP domain-containing protein 2 isoform X1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0020 Methyltransf_25 Methyltransf_31 Methyltransf_11 Ubie_methyltran MTS THUMP CMAS AviRa Methyltransf_12 Methyltransf_8 Methyltransf_15 Methyltransf_4 DUF2462
Motif
Other DBs
NCBI-GeneID: 101043632
NCBI-ProteinID: XP_003926835
UniProt: A0A2K6S6Q3
Position
Unknown
AA seq 503 aa AA seqDB search
MSVAPGEPRSGPEAAARFFCTAGRGLEPFLMREVRARLAATQVEYISGKVFFTTCSDLNM
LKELKSAERLFLLIKKQFPLTVSSVSKGKIFNEMQRLINEDPGSWLNAISIWKNLLELDA
KKEKLSQRDDNQMKRKVGENEIIIAKKLKIEQMQKMEENRDCQLGKQIEETLEQRDFTTK
RENFQEEAFQNDTEKATETHNQNDLTFRVSCRCSGTVGKAFTAQEVGKVIGIALMKHFGW
KADLRNPKLEIFIHLNDIYSVVGIPVFRVPLASRAYIKTAGLRSTIAWAMASLADIKAGA
FVLDPMCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKVSVVE
LPLPSESVDIIISDIPFGKKFKLGEDIKRILQEMERVLHVGGTIVLLLSEDHHRRLTDYK
EGSIPFNSKDSHTNEPGIKKCLIPEENTGASKTVSTSFEASNHEFLNKMSPFGSLVPVEC
YKVSLGKTDAFICKYKKSHSSGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggcgcccggggagccgcggtccgggcctgaggccgccgcccggttcttctgc
accgcgggccgcggcctggagccgttcctgatgcgggaggtgagggcgcggctggcggcc
acgcaggttgaatatatttccggaaaggtttttttcaccacctgttctgatttgaatatg
ttgaaggaattaaaatctgcagaaagattgtttttgttgattaaaaagcagtttccactt
actgtttcttctgtaagtaaaggaaaaatatttaatgaaatgcaaagacttataaatgaa
gatccaggaagttggttgaatgccatttcaatttggaaaaatcttcttgaacttgatgca
aaaaaggaaaaactttctcagagagatgataaccaaatgaaaagaaaagtgggagaaaat
gaaatcatcattgccaagaaattaaaaatagaacaaatgcaaaagatggaagagaatagg
gactgccagctgggaaaacaaatagaagaaactctggagcaaagagattttaccactaaa
agagaaaactttcaagaagaagcatttcagaatgacacggagaaagcaactgaaactcat
aatcagaatgacttgactttcagagtatcttgtcgctgcagtggaactgttggaaaggcc
ttcactgcacaggaggtaggaaaagtaattggaattgctcttatgaaacactttggatgg
aaagcagacttgaggaatccaaaattagagatctttatacatctaaatgacatttattct
gtggtggggattcctgtgttcagggttcctctagccagcagagcttacatcaagacagct
ggactgcgatctaccatagcgtgggcaatggcatctctcgctgacattaaggctggtgca
tttgttttagatccaatgtgtggacttggaacaatacttttggaagctgctaaagaatgg
ccagatgtgtattatgtaggtgctgatgtcagtgactcacagttactaggtacttgggac
aatctgaaagctgcaggcctcgaggataaaatcgaattacttaaagtctctgttgtagaa
ttgccactgccttcagaaagtgttgatattattatttctgacattccatttgggaaaaaa
tttaagttaggagaagacatcaaaaggattctacaagaaatggaaagagtgcttcatgtt
ggtggaaccattgtattgttgcttagtgaagatcaccacaggcgccttacagattataaa
gagggcagtatccctttcaattccaaggacagtcacacaaatgaacctggaattaaaaag
tgcttgattcctgaagaaaacactggtgcatccaagacagtgtcaacttcattcgaagcc
agtaaccacgagttcttaaacaaaatgtcaccatttggctccttggtcccagtagaatgc
tacaaagttagccttggaaagacagatgcgttcatatgtaaatataagaagtcacactct
tctggactgtag

DBGET integrated database retrieval system