KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044247Help
Entry
101044247         CDS       T04350                                 

Gene name
DNASE2
Definition
(RefSeq) deoxyribonuclease-2-alpha
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101044247 (DNASE2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     101044247 (DNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 101044247
NCBI-ProteinID: XP_003941774
Position
Unknown
AA seq 348 aa AA seqDB search
MIPLLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPAASGSGESVQSGLRYKYLDESSG
GWREGGGLINSSVGAVGRSLQPLYRSNRSQLAFLLYNDQPPKSSKAHISSNHGHTKGVLL
LDHDGGFWLVHSVPQFPPPDAYSWPQSAHTYGQTLLCVSFPFSQFSKIGKQLTYTYPWVY
SYQLEGVFAQEFPDLKNVTEGHHIGQEPWNSSITLTSRAGAVFQSFAKFRKFGDDLYSGW
LAAALGTNLQVQFWQKGTGILPSNCSGTWQVLNVNQIAFPGPASPSFNSTEDHSKWCVSP
LEPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKKWQPCNSW
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctgctgctgctggccgcgctgctgtgcgtccccgccggggccctgacctgc
tacggggactccgggcagcctgtggactggttcgtggtctacaagctgccagctgccagc
gggtccggcgagtcggtgcagagcgggctgcggtacaagtatctggacgagagctccggg
ggctggcgggaaggcggcggactcatcaacagctcggtgggggctgtgggccgaagcctg
cagccgctgtaccggagcaaccgcagccagctcgccttcctgctctacaatgaccaaccg
cctaaatccagcaaggctcacatctcttccaaccatgggcacacgaagggtgtcctgcta
ctcgaccacgatgggggcttctggctggtccacagtgtaccccaattccctccacctgat
gcatacagctggcctcaaagtgcccacacctacgggcagaccctgctctgtgtgtctttt
cccttcagccaattctcaaagattggcaagcagctgacctacacctacccctgggtctac
agctaccagctggaaggggtctttgcccaggaattcccagacttgaagaatgtgaccgag
ggccaccacattggccaagaaccatggaacagcagcatcacactcacatcccgggccggg
gctgttttccagagctttgccaagttccggaaatttggagatgacctatactctggctgg
ttggcagcagcccttggtaccaacctgcaggtccagttctggcaaaagggtacaggcatc
ctgccctccaactgctcagggacctggcaggttctgaatgtgaaccagatagccttccct
ggaccagccagcccaagttttaacagcacagaggaccactccaaatggtgcgtgtcccca
cttgagccctggacctgtgtgggtgacatgaatcgaaaccagggagaggagcagcggggt
gggggcacactgtgtgcccagctgccagccctctggaaggccttccagcccctggtaaag
aaatggcagccctgtaatagctggtaa

DBGET integrated database retrieval system