KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044688
Entry
101044688         CDS       T04350                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X2
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00230  Purine metabolism
sbq01100  Metabolic pathways
sbq01522  Endocrine resistance
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04114  Oocyte meiosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04727  GABAergic synapse
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04921  Oxytocin signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04976  Bile secretion
sbq05032  Morphine addiction
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101044688 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101044688 (ADCY4)
   04371 Apelin signaling pathway
    101044688 (ADCY4)
   04020 Calcium signaling pathway
    101044688 (ADCY4)
   04072 Phospholipase D signaling pathway
    101044688 (ADCY4)
   04024 cAMP signaling pathway
    101044688 (ADCY4)
   04022 cGMP-PKG signaling pathway
    101044688 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101044688 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101044688 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101044688 (ADCY4)
   04062 Chemokine signaling pathway
    101044688 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    101044688 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    101044688 (ADCY4)
   04912 GnRH signaling pathway
    101044688 (ADCY4)
   04913 Ovarian steroidogenesis
    101044688 (ADCY4)
   04915 Estrogen signaling pathway
    101044688 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    101044688 (ADCY4)
   04921 Oxytocin signaling pathway
    101044688 (ADCY4)
   04926 Relaxin signaling pathway
    101044688 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    101044688 (ADCY4)
   04918 Thyroid hormone synthesis
    101044688 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    101044688 (ADCY4)
   04916 Melanogenesis
    101044688 (ADCY4)
   04925 Aldosterone synthesis and secretion
    101044688 (ADCY4)
   04927 Cortisol synthesis and secretion
    101044688 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101044688 (ADCY4)
   04270 Vascular smooth muscle contraction
    101044688 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    101044688 (ADCY4)
   04971 Gastric acid secretion
    101044688 (ADCY4)
   04972 Pancreatic secretion
    101044688 (ADCY4)
   04976 Bile secretion
    101044688 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101044688 (ADCY4)
   04727 GABAergic synapse
    101044688 (ADCY4)
   04725 Cholinergic synapse
    101044688 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    101044688 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    101044688 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    101044688 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    101044688 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    101044688 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101044688 (ADCY4)
   04714 Thermogenesis
    101044688 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044688 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    101044688 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101044688 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101044688 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101044688 (ADCY4)
   05163 Human cytomegalovirus infection
    101044688 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101044688 (ADCY4)
Enzymes [BR:sbq01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101044688 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 101044688
NCBI-ProteinID: XP_003924311
UniProt: A0A2K6V366
Position
Unknown
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIMLCALAALLAVAWASGRELASDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTVYAMLPLGMRDATVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVLGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTARGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFGTAISSLFFFPASSDCPFQALNVSFTTSNLSWELPGSLPLISVPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLITCLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESDINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgttgctgctgctgctgctggggatcatgctctgcgcg
ctcgcggcgctgctcgccgtggcctgggccagcggcagggagctggcctcagatccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcggctgcagcgctggacgcgacccctgtcgggcttggtgtgggccgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgagac
gccaccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcccgcgctgctgccgcagttggcggcaaacgcggtgctg
tttctgtgcgggaacgtgctgggagtgtaccataaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcgcggcggaggctggacaccgagaag
aagcaccaggaacaccttcttttgtccatccttcctgcctacctggcacgagagatgaag
gcagagatcatggcacggctgcaggcaggtcaggggtcacggccagagagcaccaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaaattcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatggggttggacatgtgccgggccatcaggaaacttcgggcagctaccggc
gtggacatcaacatgcgtgtgggtgtgcactcaggcagcgtactctgcggagtcatcggg
ctgcagaagtggcagtatgatgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgttggcaggg
gcttatgctgtggaggacgcaggcatggaacatcgggacccctaccttcgggagctaggg
gagcctacctacctggtcattgatccgcgggcagaggaggaggatgagaagggcactgca
cggggcttgctgtcttcgctcgagggccccaagatgcgtccatcactgctgatgacccgc
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacgtcgacagcccg
gtgtccacctccacccctctcccggagaaggccctggcttcctttagcccccagtggagc
ctggatcggagccgtactccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcaaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
ctccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgaccaacaggcccccagctctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggtcccaagatgctgcactggctgcctgcactgtctggccttgtggccacaagaccg
ggactgagaatagccttgggcaccgccaccatcctccttgtctttggcacggccattagc
agcctgttcttcttcccagcatcatcagactgccctttccaagctctcaatgtgtccttc
acgacttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcgtgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggtggcctcctgctccctcttcctgcac
tcccatgcctggctgtccgactgcctcatcacctgcctctatctgggccccttggactcc
aggccaggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacaatggagaacctgactcggctg
ctcttggagaatgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctacgaatgtgtttgtgtcctcttcgcctcagtcccg
gacttcaaggagttctactctgaatctgacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaaacccaagttcagtggg
gtggagaagatcaaaaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgagcggagctgcagccaccttggcactatggta
gagtttgccgtggccctggggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcctgcgtgtggggttgaaccatgggccagtagtagccggagtgattggggcccag
aagccacaatatgacatttggggcaacacagtgaatgtggccagccgcatggagagcaca
ggagtccttggcaaaatccaagtgactgaggagacagcctgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctat
tttctgaatacagacttgacacgaactggacctccttcagccaccctaggctga

DBGET integrated database retrieval system