KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045176
Entry
101045176         CDS       T04350                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00230  Purine metabolism
sbq00240  Pyrimidine metabolism
sbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101045176 (DCK)
   00240 Pyrimidine metabolism
    101045176 (DCK)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101045176 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 PRK
Other DBs
NCBI-GeneID: 101045176
NCBI-ProteinID: XP_003932003
UniProt: A0A2K6U347
Position
Unknown
AA seq 260 aa
MASPPKRRCPSLSASAEGTRIKKISIEGNIAAGKSTFVNILKKVCEDWEVVPEPVARWCS
VHSTQDEFEELTTSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQLGQSLELDGIIYLRA
TPEKCLHRMYIRGRNEEQGIPLEYLEKLHHKHESWLLHRTLKTNFNYLQEVPILTLDVNE
DFKDKHESLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcctccccgccgaagagacgctgcccatctctctcagccagcgcggaggggacccgc
atcaagaaaatctccatcgaagggaacatcgcggcagggaagtcaacatttgtaaatatc
ctgaaaaaagtgtgtgaagattgggaagtggttcctgaacctgttgctagatggtgcagt
gtccatagtactcaagatgaatttgaggaacttacaacgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaaccagaacgatggtcttttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctcaatggcaagctcaaagatgcagag
aaaccggtattattttttgaacgatctgtgtatagtgacaggtatatttttgcgtctaat
ttgtatgaatctgaatgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaccaacttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttacatagaatgtatataaggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcatcataaacatgaaagctggctcctgcataggaca
ctgaaaaccaacttcaattatcttcaagaggtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgaaagtctggtggaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system