KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045219
Entry
101045219         CDS       T04350                                 

Gene name
RPAP3
Definition
(RefSeq) RNA polymerase II-associated protein 3
  KO
K23002  RNA polymerase II-associated protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101045219 (RPAP3)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101045219 (RPAP3)
SSDB
Motif
Pfam: TPR_1 TPR_2 RPAP3_C TPR_8 TPR_11 TPR_7 TPR_12 TPR_16 TPR_14 TPR_19 TPR_9 TPR_6 ANAPC3 MIT
Other DBs
NCBI-GeneID: 101045219
NCBI-ProteinID: XP_003941508
UniProt: A0A2K6TRB1
Position
Unknown
AA seq 665 aa
MTSANKAVELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGN
FRKKKKGKAKESSKKTKEENTKNRIKSYDYEAWAKLDVDSILDELDKDDSTHDSLSQESE
SEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRL
KKFAVAESDCNLAIALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNE
LRKINQALASKENSHPKEAETVIKSTEGERKQIEAQWNKQQAISEKDLGNGFFKEGKYER
AIECYTRGIAADGANALLPANRAMAYLKIEKYEEAEKDCTQAILLDGSYSKAFARRGTAR
TFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPI
DNPPHLGSTKPLKKVIIEETGNLIQTIDVPDSTTAAASESNSINLANVIAATGTTNKKNS
SQDDLFPTSDTPRAKVLKIEEISDTSSLQPQANLKQDICKSYSEKMPIQIGQKPAQFVTT
VLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDIFNQIIKILHD
FYIEKEKPSLIFEILQRLSELKRFDMAVMFMSETEKKIAHVLFNHIDKSGLKDNSVEELK
KRYGG
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgacttcagcaaataaagcagttgaattacaactacaagtgaaacaaaatgcagaagaa
ttacaagactttatgagggatttggaaaactgggaaaaagacattaaacaaaaagatatg
gaactaagaagacagaatggtgttcctgaagagaatttacctcctattcgaaatggcaat
tttaggaaaaagaagaaaggcaaagctaaagagtcttccaaaaaaaccaaagaggaaaac
acaaaaaatagaataaaatcttatgattatgaggcatgggcaaaacttgatgtggacagt
atccttgatgagcttgacaaagatgatagtacccatgattctctgtctcaagaatcagag
tcggaagaagatgggattcatgtagattctcaaaaggctcttgttttaaaagaaaagggc
aataaatacttcaaacaaggaaaatatgatgaagcaattgactgctacacaaaaggcatg
gatgccgatccatataatcctgtgttgccaacaaatagagcgtcagcgtattttagattg
aaaaaatttgctgttgctgagtctgattgtaatttagcaattgccttgaatagaagttac
acaaaagcttattccagacgaggtgctgctcgatttgctttgcaaaaattagaagaggcc
aaaaaagattatgaaagagtattagaactggaaccaaataactttgaagcaacaaatgaa
ctcaggaaaattaatcaggctttagcatccaaggaaaactcacatccgaaggaagctgaa
acagtgattaagtcaacagagggcgagcgaaagcaaattgaagcacaatggaataagcag
caggccatttcagagaaagatctgggaaatggatttttcaaagaggggaaatatgaaaga
gcaattgaatgctatactcgaggaatagcagcagatggtgccaatgcccttcttccagct
aacagagctatggcctatctgaagattgagaaatatgaagaagctgaaaaagactgcaca
caagccattttattagatggctcatattctaaagcttttgccagaagaggaactgcaaga
acatttctgggaaagctaaatgaggcaaaacaagattttgaaactgttttacttctggaa
cctggaaataagcaagcagtaactgaactctccaaaattaagaaggaattaattgagaaa
ggacactgggatgatgtctttcttgattccacacaaagacaaaatgtggtaaaacccatt
gataatccaccacatcttggatcaactaaaccactcaagaaggttattattgaagaaact
ggtaatttgatacagactattgatgtgccagacagcactactgctgctgcctcagaaagt
aattctattaatctagcaaatgtgatagcagccacaggcaccacaaataagaagaattca
agccaagatgacctttttcccacaagtgatactccaagagcaaaagtattgaaaatagaa
gaaatcagtgatacgtcatccttacaacctcaagccaatttgaaacaggatatatgtaaa
tcttacagtgagaaaatgcctatacagataggacaaaaacctgctcagtttgtcacaact
gttcttcctccaattcccgcaaactcgttccagcttgaatctgatttcagacaattgaaa
agttctccagatatgttgtatcagtacttaaagcaaattgaaccatctttatatcctaag
ttgtttcagaaaaatctggatccggatatattcaaccagatcattaaaattctgcatgac
ttttacattgagaaagaaaagccatcacttatctttgaaatcttacaaagactttctgaa
ctaaaaaggtttgatatggcagtaatgtttatgtcagaaacagagaaaaagattgcacat
gtattatttaatcacatagacaaatcaggattgaaggataattctgttgaagaactcaag
aaaagatacggtggttga

DBGET integrated database retrieval system