KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045519
Entry
101045519         CDS       T04350                                 

Gene name
DRAP1
Definition
(RefSeq) dr1-associated corepressor
  KO
K21752  Dr1-associated corepressor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101045519 (DRAP1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101045519 (DRAP1)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone FXMRP1_C_core TAF4
Other DBs
NCBI-GeneID: 101045519
NCBI-ProteinID: XP_003937768
UniProt: A0A2K6S4X0
Position
Unknown
AA seq 205 aa
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGEKGPRRGRKPGSGSRK
NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPAQASHPPAHFQSPPTPFLPFA
STLPLPPAPPGPSAPDAEDEEDYDS
NT seq 618 nt   +upstreamnt  +downstreamnt
atgccgagcaagaagaagaagtacaacgcgcggttcccgccggcgcggatcaagaagatc
atgcagacggacgaagagattgggaaggtggcggcggcagtgcctgtcatcatctcccgg
gcgctcgagctcttcctagagtcgctgttgaagaaggcctgccaggtgacccagtcccga
aacgccaagaccatgaccacatcccacctgaagcagtgcatcgagctggagcagcagttt
gacttcttaaaagacctggtggcatctgtgcccgacatgcagggagacggggaggacaac
cacatggatggggaaaagggcccccgcaggggccggaagccaggcagtggcagccgaaag
aacggtgggatgggaacgaaaagcaaggacaagaagctgtccgggacagactcagagcag
gaggatgaatctgaggacacagacactgacggagaagaagagacatcgcaacccccagcc
caggccagccacccgcctgcccactttcagagccccccgacacccttcctgcccttcgcc
tctactctgcctttgcccccagcgcccccaggcccctcagcaccagacgcagaagatgaa
gaggattacgactcctag

DBGET integrated database retrieval system