KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046706Help
Entry
101046706         CDS       T04350                                 

Gene name
PARP9
Definition
(RefSeq) poly [ADP-ribose] polymerase 9 isoform X1
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101046706 (PARP9)
Enzymes [BR:sbq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101046706 (PARP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP Bromo_TP_like
Motif
Other DBs
NCBI-GeneID: 101046706
NCBI-ProteinID: XP_010350722
UniProt: A0A2K6T5P7
Position
Unknown
AA seq 817 aa AA seqDB search
MEFSTGARAAAYNEKSETDTLKENYSWHIPINHDDFKILKPNESQLCEVLQSKFGCISTL
VSPVQEVNSKSLQVFKKMLAPGLELSVWKDDLTRHAVDAVVNAANEDLLHGGGLALALVT
AGGLEIQEESKEFVARHGKVPTGGIAVTRAGRLPCKEIIHAVGPRWTVWDKQGCIEKLKK
AIGSILNYVIYRNTHIKTVAIPALSSGIFQFPLSLCTQIIVETIQVNLRGMLMRNNLKEI
HLVSNEDPTVAAFKAASECILGKSELGQETTPSFNTMVVNNLTLEIVLGHIEQQMAEVIV
NSVNPCDITAGSVAKSILQQAGVEMLKEFLDTKAKQFPSLQLVLVTRGFNLSCRYVYHVL
WYSEFPKDINLKLAMKTCLEKCVEQNITSISFPALGTGNMEIKKETAAEMLFDEVLTFAK
DHLKHQLTVKFVILPTELEIHKIFCAEMAKRSQMLSLNSVPRSSREKKRENGPEATSPAI
NLMGFNKEEMCEAQAWIKRILSLPYHHIIENNHILYLGKKEHGILSQLQKTSSVTITEIT
SPERTKLEIAGAQADFIEVVMKIEDMLCKVQEEMARKKEQSLWSFLGQWCNQQQKTQDEK
KENILFLKYPVTLTQELLDQKKQFEKCGLQVLKVEKIDNKVLMAAFQLKKKMMEGKPHRQ
PVSHRLFQQVPHQFCKVVCRVGFQRTYSVPCDPKYGVGIYFTKNLKSLAEKAKETSAVDE
LICVFEAEVLTGSFCQGHQLNIGPPPLSPGAVDSHDSVVDSVSSPETFVIFSSMQAIPLY
LWTCTKGYVQSQDYSSGPIRSFVQYPWKGLTSGSPVD
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggagttttccacgggtgccagagcagcagcttacaatgaaaaatcagagacagacact
cttaaagaaaactatagttggcacattcccattaaccatgacgacttcaaaattttaaaa
cctaatgagagtcagctgtgtgaagtcctccagagtaagtttggctgtatctctaccctg
gtctctccagttcaggaagtcaacagcaaatctctgcaagtgttcaaaaaaatgctggct
cctgggctagagttatcggtttggaaagatgacctcaccagacatgctgttgatgctgtg
gtgaatgcagccaatgaagatcttctacatggaggaggcctggccctggccctggtgaca
gctggtggacttgaaatccaagaagagagcaaagagtttgttgccagacatggtaaagta
ccaactggggggatagctgtcacaagagccgggaggcttccctgcaaagagatcatccat
gctgttggccctcggtggacagtatgggataaacagggatgtattgaaaagctgaagaag
gccattggaagtattctgaattatgtcatctacagaaatactcacattaagacagtagca
attccagccctgagctctgggatttttcagttccctctgagtttgtgtacgcagattatt
gtagagactatccaggttaatttgcgagggatgctgatgaggaataatttgaaagaaatt
cacctggtgagcaatgaggaccctactgttgctgcctttaaagctgcttcagaatgcatc
ctagggaagagtgagctgggacaagaaaccactccttctttcaatacaatggttgtgaac
aacctcacccttgagattgtcctgggccacattgaacagcagatggcagaagtaattgtt
aattctgtaaacccatgtgatattacagctggatctgtggcaaagtcaattctacaacaa
gcaggagttgaaatgctaaaggagtttcttgacacaaaggctaaacagtttccatcgttg
cagttggtactggtcacaagaggatttaacttgtcctgtcgatatgtataccatgtactg
tggtattcagaatttcctaaagatattaacttaaaacttgcaatgaagacgtgtttagaa
aaatgcgttgagcaaaacataacatctatttcctttcctgcccttgggaccggaaacatg
gaaataaagaaggaaacagcagcagagatgttatttgatgaagttttaacatttgccaaa
gaccacttaaaacaccagttaactgtaaagtttgtgatcttaccaacagaattagagata
cataagattttctgcgctgaaatggcaaagaggtcccagatgctgagtctgaacagtgtc
cccaggtcatccagagagaagaaaagagaaaatggacctgaagctacatctcctgccatc
aatctgatgggattcaataaagaagaaatgtgtgaggcccaagcatggatcaagagaatt
ttgagtctcccttaccatcacatcattgagaataaccatattctgtaccttgggaaaaag
gaacatggtattttgtctcagcttcagaaaacttcaagtgtcaccatcacagaaattacc
agcccagaaaggacaaaattagagattgcaggagcccaggctgacttcattgaggtggtt
atgaagattgaagatatgctttgtaaagtacaggaagaaatggcaaggaaaaaggagcaa
agcctttggagcttcttaggacagtggtgtaatcagcaacagaaaacccaagacgaaaag
aaagaaaatatcttatttctgaaatatcctgtgactttaactcaagagcttctggatcag
aagaagcagtttgaaaaatgtggtttgcaggttttaaaggtggagaagatagacaataaa
gttcttatggccgcctttcaactaaaaaagaaaatgatggaaggaaaaccccacaggcaa
cctgtgagccacagactgtttcagcaagtcccacaccagttctgcaaggtggtatgcaga
gttggttttcaaaggacgtactcggtgccctgcgatccaaaatatggagttggcatatac
ttcaccaagaacctcaaaagcctggcagagaaggccaaggaaacctctgctgtagatgag
ctgatctgtgtattcgaggctgaagtacttacaggctccttctgccagggacatcagtta
aatattggtcccccaccactaagtcctggagctgtagatagtcatgacagtgtggttgac
agtgtctccagccctgaaacctttgttatttttagtagcatgcaggctatacccctgtat
ttgtggacatgcaccaagggttatgtgcagtcacaagattactcatcaggaccaataaga
tcctttgtacagtatccttggaagggattaacaagtggcagccctgttgattaa

DBGET integrated database retrieval system