KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048190Help
Entry
101048190         CDS       T04350                                 

Gene name
NOP58
Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    101048190 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sbq03009]
    101048190 (NOP58)
Ribosome biogenesis [BR:sbq03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    101048190 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop Cellulose_synt
Motif
Other DBs
NCBI-GeneID: 101048190
NCBI-ProteinID: XP_003925690
Position
Unknown
AA seq 469 aa AA seqDB search
MEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQM
DGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRC
REWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSEFLPEEVEAEVKAAAEISMG
TEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIAHAG
SLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLA
AKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKS
EVKTYDPSGDSTLPTCSKKRKIEQVDKEDDITEKKAKKAKIKVKVEEEEEEEEEEVVEEE
ETSVKKKKKKGKKKHIKEEPLSEEEPCTSTTIPSPEKKKKKKKKRDNED
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggagggtaaaatcaataagcagctgaagaaagttcttaagaaaatagtaaaagaagcc
catgaaccgttggcagtagctgatgctaaactaggaggggtcataaaggaaaagctgaat
ctcagttgtatccatagtcccgttgttaatgaacttatgagaggaattcgttcacaaatg
gatggattaattcctggcgtagaaccacgtgaaatggcagctatgtgtcttggattggct
cacagcctatctcgatatagattgaaatttagcgctgataaagtagacacaatgattgtt
caggcaatttccttgttagatgacttggataaagaactaaacaactacattatgcgatgt
agagaatggtatggctggcatttccctgaattaggaaaaattatttcagataatttgaca
tactgcaagtgtttacagaaagttggcgataggaagaactatgcctctgccaaactttct
gagttcctaccagaagaagttgaagcagaagtgaaagcagctgcggagatatcaatggga
acagaggtttcagaagaagatatttgcaatattctgcatctttgcacccaggtgattgaa
atctctgaatatcgaacccagctctatgaatatctacaaaatcgaatgatggccattgcg
cccaacgttacagtcatggttggggaattagttggagcacggcttatcgctcatgcaggt
tctcttttgaatttggccaagcatgcagcttctacagttcaaattcttggagcagaaaag
gcacttttcagagccctcaaatctagacgggatacccctaagtatggtctcatttatcat
gcttcactcgtcggccagacaagtcccaagcataaaggaaagatttctcgaatgctggca
gccaaaactgttttggctatccgttatgatgctttcggtgaggattccagttccgcgatg
ggagttgagaacagagccaaattagaggccaggttgagaactttggaagatagagggata
agaaaaataagtggaacaggaaaggcattagcaaagacagaaaaatatgaacacaaaagt
gaagtgaagacttacgatccttctggtgactccacacttccaacctgttctaaaaaacgc
aaaatagaacaggtagataaagaggatgatattactgaaaagaaagcaaagaaagccaag
attaaagttaaagttgaagaagaggaagaagaagaagaagaagaagtggtagaagaagaa
gaaacatctgtgaagaagaagaagaaaaagggtaaaaagaaacacattaaggaagaacca
ctttctgaggaagaaccatgtaccagcacaacaattcctagtccagagaaaaagaagaaa
aagaaaaaaaagagagataatgaggactaa

DBGET integrated database retrieval system