KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048761
Entry
101048761         CDS       T04350                                 

Gene name
CSRNP1
Definition
(RefSeq) cysteine/serine-rich nuclear protein 1
  KO
K17494  cysteine/serine-rich nuclear protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101048761 (CSRNP1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101048761 (CSRNP1)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101048761 (CSRNP1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101048761 (CSRNP1)
SSDB
Motif
Pfam: CSRNP_N
Other DBs
NCBI-GeneID: 101048761
NCBI-ProteinID: XP_003930937
UniProt: A0A2K6TUC0
Position
Unknown
AA seq 627 aa
MRILAGSPPAAACLPLRVFSFPFQAVCPRLQSARCTTMTGLLKRKFDQLDEDNSSVSSSS
SSSGCQSRSCSPSSSVSRAWDSEEEGPWDHMPLPDHDFCGPRSSTPLSILKRARRERPGR
VAFDGITVFYFPRCQGFTSVPSRGGCTLGMAPRHSACRRFSLAEFAQEQARARREKLRQR
LKEEKLEMLQWKLSAAGTPKTEAGLPPPVDAIDDASVEEDLAAAVAGGRLEEVSFLQPYP
ARRRQALLRASGVRRIDREEKRELLALRQSREDCGCHCDRVCDPETCSCSLAGIKCQMDH
TAFPCGCCKEGCENPVGRVEFNQARVQTHFIHTLTRLQLEQEAESFRELEASAQGSPPSP
GEQALVPTFSLAKPIMSSELGDNSCSSDMTDSSTASSSASGGSEAPDCPTHPGLPGSGFQ
PGVDDDSLARILSFSDSDLGGEEEEEEEEGSVGNLDNLSCFHPADIFGTSDPGGLASWTH
SYSGCSFTSGILDENANLDASCFLNGGLEGSREGGLPGTSVPPGMDAGQSSSVDLSLSSC
DSFELLQALPDYSLGPHYTSQKVSGGLDNIEAPHFPLAGPCPPGDVSTCFLESLMGLSEP
AAEALDPFIDSQFEDAVPASLMEPVPV
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgaggatcctggctgggagcccacctgctgctgcctgcctgccacttagagtcttctca
ttcccattccaggctgtctgtccccggctacagagcgcccggtgcaccaccatgactggg
ctgttgaagaggaaatttgaccagctggatgaggacaactcctcggtctcctcctcctcc
tcttcctctgggtgccaatctcgctcctgctctccaagctcttctgtctcccgtgcctgg
gactcagaggaggaaggtccctgggatcacatgcccctgcctgaccatgacttctgtggc
cccagaagttctacccccctgtctatcctgaagcgggctcgccgggagcgcccaggccgg
gtagcctttgatgggatcaccgtcttctacttcccccgttgccagggcttcaccagtgtg
cccagccgtggcggctgcactctgggcatggcccctcgccacagtgcctgccgccgcttc
tctttggctgagtttgcacaggagcaagcccgagcccggcgcgagaaactccgccagcgc
ttgaaagaggagaagttggagatgctgcagtggaagctttcggccgctgggacacccaaa
acagaggcagggctgccgcctccggtggatgccatcgatgatgcctctgtggaggaggac
ttggcagctgctgtggcaggtggccggttggaagaagtgagcttcctacagccataccca
gcccggcgacgtcaagctctgctgagggcttcaggcgtgcgaaggatcgatcgggaagag
aagcgggagctgctggcactgcgccaatcccgggaggattgtggctgtcactgtgacagg
gtctgcgaccctgagacctgcagctgcagcttggcaggcatcaagtgccagatggaccac
accgcgttcccctgtggctgctgcaaggagggctgtgagaaccctgtgggccgtgtggag
tttaatcaggctagagttcagacccatttcatccacacactcacccgcctgcagttagag
caggaggctgagagctttagggagctggaggcctctgctcagggcagcccacccagccct
ggtgagcaggccctggtccccactttctcactggccaagcccataatgagcagcgagctg
ggagacaacagctgcagcagcgacatgactgattcctccacggcatcgtcgtcagcatcg
ggcggtagtgaggcccctgactgccccacccacccaggcctgcctggctccggcttccag
cctggcgtggatgatgacagcctggcacggatcctgagtttcagtgactctgacctcggc
ggggaggaggaggaggaggaggaagaagggagtgtggggaacctggacaacctcagctgc
ttccatccagctgacatctttggtactagtgaccctggtggcctggccagctggacccat
agctattctggctgtagcttcacatcaggcatcctggatgaaaatgccaacctggatgcc
agctgcttcctaaatggtggccttgaagggtcaagagaaggcggccttcctggcacctca
gtgccacccggcatggacgctggccagagcagctcagtggatctcagcttgtcttcctgt
gactcctttgagttactccaggctctgccagattatagtctggggcctcactacacatca
cagaaggtgtctggcggcctggacaacattgaggcacctcacttccccctggctggcccc
tgtccacctggggatgtcagcacttgcttcctggagtccctcatgggcctctccgagcca
gccgccgaagccctagatccctttatcgacagccagtttgaggacgctgtcccggcgtct
ctgatggagcctgtgccggtgtga

DBGET integrated database retrieval system