KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050037
Entry
101050037         CDS       T04350                                 

Gene name
SPTY2D1
Definition
(RefSeq) protein SPT2 homolog
  KO
K15193  protein SPT2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101050037 (SPTY2D1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101050037 (SPTY2D1)
SSDB
Motif
Pfam: SPT2
Other DBs
NCBI-GeneID: 101050037
NCBI-ProteinID: XP_003919946
UniProt: A0A2K6SEJ5
Position
Unknown
AA seq 685 aa
MDFREILLIASKGQGVNNVPKRYSLAVGPPKKDPKVKGVQSAAVQAFLKRKEEELRQKAL
EEKRRKEELVKKRIELKHDKKARAMAKRTKDNFHGYNGIPIEEKSKKRQATESHTSQGTD
REYEMEEEDELLEYNHAESEQEYEEEQEPPKVESKPKVPLKSAPPPMNFTDLLRLAEKKQ
FEPVEIKVVKKSEERPMTAEELREREFLERKRRRKKLETDAKLPPTVSKKTPSQKESVGT
KLSKGSGDRHPSSKGMPLPHAEKKSRPSMANEKHLALSSSKSMPGERIKAGSGKSSQPLL
REGHDRPVFNGAGKPHSSICSPSIPKTSASRTQKSAMEHKAKKSPSQPSHSRPGPMVTPH
NKAKSPGVKQPGSSSSLAPGQPSTGVARPTVSSGPVPRRQNGSSSSGPERSISGSKKPTN
GSHPSGRTVTGTCGPGQPASNSSGPGRPISGSGSSARPLGSSRGPGRPMNSPHELRRPVS
GSGPPGRSVSGLGRSISSSIPVGRTVNSSVPGRPVSSLGPGRAVSSSGPTIKPKCTVVSE
TISSKNIISRSSNGQMNGMKPPLSGYRSAQGPQRLPFPTGYKRQRDYEEEDDDDDEYDSE
MEDFIEDEGEPQEEISKHIREIFGYDRKKYKDESDYALRYMESSWKEQQKEEAKSLRLGM
QEDLEEMRREEEEMQRRRAKKLKRR
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggacttcagagaaattctcctgatagcttccaagggacaaggtgtcaacaatgtgccg
aaaaggtatagtttggcagtggggcctccaaaaaaagacccaaaagttaaaggtgtccaa
tcagcagctgtacaagcttttcttaaaagaaaagaagaggaactcagacaaaaagcctta
gaggagaagaggagaaaagaagaactagtgaaaaagcgaattgagctcaaacatgacaag
aaagcaagagctatggccaagaggacaaaggataatttccatggttacaatgggatccct
attgaggaaaagtcaaagaagaggcaggcaacggaaagccataccagccaaggaaccgac
cgagagtatgaaatggaagaagaggatgaactccttgaatacaatcatgcagagtcagag
caggagtatgaggaagagcaggaacctcccaaggttgaaagcaaaccaaaggtccccctt
aaaagtgccccaccacccatgaacttcactgatttactcagactggctgagaaaaagcag
tttgaaccagtggaaatcaaggtagtgaagaaatcggaagagcgacctatgactgcagaa
gaacttagggagcgagaattccttgaacgaaagcgtaggagaaaaaaacttgagacagat
gctaaactacctccaactgtgtccaaaaagacaccctctcagaaagaaagtgtgggcaca
aaacttagcaaaggttctggagacaggcatccttcttccaaaggaatgccccttcctcat
gctgagaagaaatcaagacccagcatggccaatgagaagcacttagctttgtcttcatcc
aaatccatgccaggagagaggatcaaggcaggatctggcaaaagctcccaacccttactt
cgtgagggtcatgacagacctgttttcaatggagctggaaagcctcattccagcatctgt
tcaccaagtatcccaaagacttctgctagcaggactcagaaatctgctatggagcacaaa
gccaaaaaatctccatcccaacctagccattccaggcctgggcccatggtcaccccacac
aataaggctaagagtccaggtgtcaagcagccaggcagcagctctagcttagcccctggg
cagcccagcacaggagttgctcggcccacagttagttctggccctgtgcccaggcgccag
aatggcagctccagctcaggacctgagcgatcaatcagtgggtccaagaagccaaccaat
ggctcacatccctctgggcggacagtcactggtacatgtggtcctggacaacctgcaagc
aactcaagtggccctgggcgacctatcagtggttcaggtagttctgcaagaccgttgggc
agctctcgtggccctgggcggcctatgaacagtccacatgaacttcgacgaccagtgagt
ggctcaggcccccctgggcggtcagtcagtggcctggggagatccataagtagctcaatt
ccagtaggacggactgtcaatagttcagtcccaggaagaccagtgagtagcttgggacct
gggcgagcagttagtagctcaggtcccaccataaagcctaagtgtactgttgtctcagaa
acaatttcttccaagaatatcattagccggtccagcaatggacagatgaatggaatgaag
cctcccctgtctggctacagatctgcccaaggtcctcaaaggcttccattccctactggt
tacaaaaggcagcgagactatgaagaggaagatgacgacgatgacgaatatgactctgaa
atggaagattttatcgaagatgaaggagagcctcaggaagaaatatccaagcacattaga
gaaatctttggttatgaccgaaaaaaatacaaagatgaaagtgattatgccttacgttac
atggaaagtagttggaaagagcagcagaaggaagaagcaaagagcttaagactaggtatg
caagaggacttagaggaaatgagacgggaagaagaagaaatgcaacgtcgaagggccaag
aagctgaagaggcgttag

DBGET integrated database retrieval system