KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051348
Entry
101051348         CDS       T04350                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101051348 (AKAP5)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101051348 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101051348
NCBI-ProteinID: XP_003924474
Position
Unknown
AA seq 426 aa
MATTVSEIHVENKDEKRSAEGSPRAERQEEKTSMLCFKRRKKAAKALKPKAGSEAADVTR
KCPQEAGVSDQPEPPRGAWASLKHLVTRRKRSESSKQQKPLEAEVQPEINAEDADLSKKK
AKSRLKIPCIKFQRGPKRRNHSKIIEDSVCSIKVQGEAENLDLQTQTPSNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDNGHSAIQKGALILEEIETIKEKQ
DVQPQQASPLQTSETDHRQPVPSDVTPLPTVPDQQIVEEASNNILESAPNGKDYESGETV
AEETKPKDTELSQEPDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVKKSKNVPK
QFLISTESEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDK
INNLLQ
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcaaccacagtttcagaaattcatgtagaaaacaaagatgagaagagatcagcagaa
ggtagtcctcgggctgaaagacaggaggagaaaacatccatgctttgcttcaagagacga
aagaaagcagctaaagcattgaagcccaaagctggctctgaagctgctgatgtaacaagg
aagtgtccacaagaagcaggagtttctgatcagccagagcccccacggggggcctgggcc
tcactcaaacatcttgtaacacgcaggaaaaggtcggagtcttcaaagcagcaaaagcca
ttggaggctgaagtgcaacctgaaataaatgctgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattccaaagagggccaaaaaggaggaat
cactccaaaattatagaagactcagtctgcagcatcaaagtccagggagaggctgaaaat
ctggatctacaaacacagaccccatcaaacgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaggtctgtgaatcaaatgtgagc
aatagcattacttccggagagaaagtgatttcagtagaacttggattagataatgggcat
tctgctattcaaaagggagctctaatccttgaagaaattgaaacaatcaaggaaaaacaa
gatgttcaaccccagcaagcaagcccacttcaaacttcagaaacagaccatcggcaacca
gtaccttctgatgttactcctttacctacagtcccagatcaacaaattgtagaagaagcc
agtaacaatatcctagaaagtgcaccaaatgggaaagactatgaaagcggagagactgtg
gctgaagaaactaagccaaaagatacggaattgagccaagaaccagattttaaagaaaat
gggatcactgaagagaaatccaaatcagaagaaagcaaaagaatggagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaag
caattcttaatttcaacagaaagtgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctcttgtc
aagaatgctattcagttgtcaatagaacagctggttaatgaaatggcatctgatgataaa
ataaacaatcttctacagtga

DBGET integrated database retrieval system