KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051562Help
Entry
101051562         CDS       T04350                                 

Gene name
MMP3
Definition
(RefSeq) stromelysin-1
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04657  IL-17 signaling pathway
sbq04668  TNF signaling pathway
sbq05202  Transcriptional misregulation in cancer
sbq05215  Prostate cancer
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101051562 (MMP3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101051562 (MMP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101051562 (MMP3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101051562 (MMP3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101051562 (MMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101051562 (MMP3)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     101051562 (MMP3)
Peptidases and inhibitors [BR:sbq01002]
 Metallo peptidases
  Family M10
   101051562 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin DUF4953 Reprolysin_5 Reprolysin_4 Peptidase_M57 Reprolysin_3 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 101051562
NCBI-ProteinID: XP_003923817
UniProt: A0A2K6UPU1
Position
Unknown
AA seq 477 aa AA seqDB search
MKSLPFLLLLCMAVCSAYPLDGAARDEDARMDLVQQYLENYYNLEKDGKQFVRRKDSSPV
VKKIQEMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFNTFPGMPKWRKTHLTYRIVN
YTLDLPKDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGKV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHELGHTLGLFHSDNTEALMYPVY
NPLTDLTRFHLSQDDVNGIQSLYGPHPGSPEKPLVPKETVPPETETPATCDPALSFDAIS
TLRGEILFFKDRHFWRKSLRKLEPELYLISSFWPSLPSGMDAAYEVTSKDLVFIFKGSQF
WAIRGNEVQAGYPRGIHTLGFPPTVRKIDAAISDKEKKKTYFFVEDKYWRFDEKRHSMEP
GFPKQIAEDFPGIDSKVDAVFEKFGFFYFFTGSSQLEFDPNAKKVTHVLKSNSWFNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcttccattcctacttttgctctgcatggcagtttgctcagcctatccgttg
gatggagctgcaagggatgaggatgccagaatggaccttgttcagcaatacctagaaaac
tactacaacctcgaaaaagatgggaaacagtttgttagaagaaaggacagtagtcctgtt
gttaaaaaaatccaagaaatgcagaagttccttgggttggaggtgacagggaagctggac
tctgacactctggaggtgatgcgtaagcccaggtgtggagttcctgacgttggtcacttc
aacacctttcccggcatgccaaagtggaggaaaacccaccttacatacaggattgtgaat
tatacactagatttgccaaaagatgctgttgattctgccattgagaaagctctgaaagtc
tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg
atctcttttgcagttagagaacatggggacttttacccttttgatggacccggaaaagtt
ttggctcatgcctatgcccctgggccagggattaacggagatgcccactttgatgatgat
gaacaatggacaaaggatacaacagggaccaatttattccttgttgcggctcatgaactt
ggccacaccctgggtctctttcactcagacaacactgaagctttgatgtacccagtctac
aacccactcacagatctgactcggttccacctgtctcaagatgatgtgaatggcattcag
tccctctatggacctcaccctggttcccctgagaaacctctggtgcccaaggaaactgtc
cctccagaaactgagacaccagccacatgcgatcctgctttgtcctttgatgccatcagc
actctgagaggagaaatcctattctttaaagacaggcacttttggcgcaaatctctcagg
aagcttgaacctgaattgtacttgatctcttcattttggccctctcttccttcaggcatg
gatgccgcatacgaagttactagcaaggatcttgttttcatttttaaaggaagtcagttc
tgggccatcagaggaaatgaggtacaagctggatacccaagaggcatccacaccctaggt
ttccctccaaccgtaaggaaaattgatgcagccatttctgacaaggaaaagaagaaaaca
tacttctttgtagaggacaaatactggagatttgatgagaagaggcattccatggagcca
ggctttccaaagcaaatagctgaagacttcccagggattgactcaaaggttgatgctgtt
tttgaaaaatttgggtttttttatttcttcactggatcttcacagttggagtttgaccca
aatgcaaagaaagtgacacacgttttgaagagtaacagctggtttaactgttaa

DBGET integrated database retrieval system