KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051757Help
Entry
101051757         CDS       T04350                                 

Gene name
PRODH2
Definition
(RefSeq) probable proline dehydrogenase 2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00330  Arginine and proline metabolism
sbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101051757 (PRODH2)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     101051757 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh Ank_2 Ank_5 Ank_3 Ank Ank_4
Motif
Other DBs
NCBI-GeneID: 101051757
NCBI-ProteinID: XP_010346354
Position
Unknown
AA seq 532 aa AA seqDB search
MLQTCRALCSQAGPPSRSCPPLKFDGGAFQLKHTKELTRALLVLRLCAWPPLVTHGLALQ
AWSQRLLGSRLSGAFLRASFYGQFVAGETAEEVRDCVQQLRTLGLRPLLAVPTEEEPDST
AKTGEACYEGNLGVMLRGVDLSRSLLEPLSQPSFMQLKVTALTSTRLCKELTSWVRRPGA
SLELSPERLAEAMDSGQSLQVSCLNAEQNQHLQASLSRLHRVAQHARARHVRLLVDAEYT
SLNPALSLLVAALAMRWNSPGEGGPWVWNTYQAYLKDTLERLERDTEAAHRAGLAFGVKL
VRGAYLDKERAVARLQGTEDPTQPDYEATSRSYSRCLELMLTHVARHSPMCHLMVASHNE
ESVRQATKCMWELGIPLDGPVCFGQLLGMCDHVSLALGVQVDGENSEGQTALFLSALLGH
SSAVQLLLTFGANPNHRCLDGSTPTHAGAFSGRSLVMVPLLQAGGDLRLHDQRGRTPRDW
AEQGGAQQNWEVSSGLGGSESESSGPAPTGPHPTCPPPGAGAEETMVGAGHS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctccagacctgccgcgcgctctgttctcaagccggtcccccctccaggagctgtcca
cccctgaaatttgatggcggcgccttccaactcaagcacacgaaagagctgacacgggcc
ttgctggttctccggctgtgtgcctggcccccactagtcacccacgggttggcgctccag
gcctggtctcagcgactcctgggctcccggctctcgggcgcgtttctccgagcatccttc
tacgggcagtttgtggccggtgagacagcagaggaggtgagggactgcgtgcagcagctt
cggaccctcggcctccggccgctgctggcagtgcccactgaggaggagccggactccact
gccaagactggtgaggcctgctacgaggggaacctcggtgttatgctgcggggtgtggac
ctgtcacggagtctcctggagcccctcagccagcccagcttcatgcagctgaaggtgacg
gcgctgaccagcactcggctctgtaaggagctaacctcatgggtcagaaggccaggggcc
tccttggagctgagccctgagaggctggccgaagccatggactctgggcagagcctccag
gtttcctgtctcaatgcggagcagaaccagcacctccaggcctccctcagccgcttgcac
cgggtggcacagcatgcccgggcccggcacgtgcggctcctggtggatgcagagtacacc
tcactgaaccccgcactctcactgcttgtggctgccctggccatgcgctggaacagcccg
ggggaaggcgggccctgggtgtggaacacctaccaggcctatctaaaggacacacttgag
cggctggagcgggacacagaggccgcgcacagggctggcctggccttcggagtgaagctg
gtacggggtgcgtatctggacaaggagagagcagtggcccggctccaagggaccgaagac
cccactcagcctgactatgaggccaccagtcggagttacagccgctgcctggaactgatg
ctgacgcatgtggcccgccatagccctatgtgccacctcatggtggcttcccacaatgag
gaatctgttcgccaagcaaccaagtgcatgtgggagctgggcattcctctggacgggcct
gtctgtttcggacaacttctgggcatgtgtgaccacgtctctctggcactaggtgtccag
gtggatggggaaaactccgaggggcagacggcgctcttcctgtcagcgctgctgggccac
agctctgccgtgcagctcctgctgacctttggagccaaccccaaccaccgctgcctggat
ggcagcacacctacacatgcaggcgccttctctggccgaagcctggtcatggtgcccctg
ctgcaggcggggggtgacttgcgactgcatgaccagcggggtcgcaccccccgagactgg
gctgagcagggtggggcccagcagaactgggaggtgagcagtggccttggtgggagcgag
agcgagagttccgggccggctcccactgggcctcaccccacgtgccctcctccaggtgct
ggagctgaggagacaatggtgggtgctgggcacagctga

DBGET integrated database retrieval system