KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052292
Entry
101052292         CDS       T04350                                 

Gene name
BTAF1
Definition
(RefSeq) TATA-binding protein-associated factor 172
  KO
K15192  TATA-binding protein-associated factor [EC:3.6.4.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101052292 (BTAF1)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     101052292 (BTAF1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101052292 (BTAF1)
SSDB
Motif
Pfam: DUF3535 SNF2_N HEAT Helicase_C Vac14_Fab1_bd Cnd1 HEAT_EZ Rac1
Other DBs
NCBI-GeneID: 101052292
NCBI-ProteinID: XP_003922444
UniProt: A0A2K6T5A3
Position
Unknown
AA seq 1849 aa
MAVSRLDRLFILLDTGTTPVTRKAAAQQLGEVVKLHPHELNNLLSKVLIYLRSANWDTRI
AAGQAVEAIVKNIPEWNPVPRTRQEPTSESSMEDSPTTDRLNFDRFDICRLLQHGASLLG
SAGAEFEVQDEKSGEVDPKERIARQRKLLQKKLGLNMGEAIGMSTEELFNDEDLDYTPTS
AALVNKQPTLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEKSNDSTDG
EPEEKRRKIANVVINQSANDSKVLIDNISDSSSLTEETNEWPLESFCEELCNDLFNPSWE
VRHGAGTGLREILKAHGKSGGKMGDSTLEEMIQQHQEWLEDLVIRLLCVFALDRFGDFVS
DEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVR
QDVINTLLPKVLTRIIEGLQDLDDDVRAVAAASLVPVVESLVYLQTQKVPFIINTLWDAL
LELDDLTASTNSIMTLLSSLLTYPQVQQCSIQQSLTVLVPRVWPFLHHTISSVRRAALET
LFTLLSTQDQNSSSWLIPILPDMLRHIFQFCVLESSQDILDLIHKVWMELLSKASVQYVV
AAACPWMGAWLCLMMQPSHLPIDLNMLLEVKARAKEKTGGKMRQGQSQSKEVLQEYIAGA
DTIMEDPATRDFVVMRARMMAAKLLGALCCCICDPGVNVVTQEIKPAESLGQLLLFHLNS
KSALQRISVALVICEWAALQKECKAVTLAVQPRLLDILSEHLYYDEIAVPFTRMQNECKQ
LISSLADVHIEVGNRVNNNVLTIDQASDLVTTVFNEATSSFDLNPQVLQQLDSKRQQVQM
TVTETNQEWQVLQLRVHTFAACAVVSLQQLPEKLNPIIKPLMETIKKEENTLVQNYAAQC
IAKLLQQCTRRTPCPNSKIIKNLCSSLCVDPYLTPCVTCPVPTQSGQENSKGSTSEKDGM
HHTVTKHRGIITLYRHQKAAFAITSRRGPTPKAVKAQIADLPAGSSGNILVELDEAQKPY
LVQRRGAEFALTTIVKHFGGEMAVKLPHLWDAMVGPLRNTIDINNFDGKSLLEKGDGPAQ
ELVNSLQVFETAAASMDSELHPLLVQHLPHLYMCLQYPSTAVRHMAARCVGIMSKIATME
TMNIFLEKVLPWLGAINDSVKQEGAIEALACVMEQLDVGIVPYIVLLVVPVLGRMSDQTD
SVRFMATQCFATLIRLMPLEAGIPDPPNMSAELIQLKAKERHFLEQLLDGKKLENYKIPV
PINAELRKYQQDGVNWLAFLNKYKLHGILCDDMGLGKTLQSICILAGDHCHRAQEYARSK
LAECMPLPSLVVCPPTLTGHWVDEVGKFCSKEYLNPLHYTGPPTERVRLQHQVKRHNLIV
ASYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAVKQLTANYRIILSGTPIQNNV
LELWSLFDFLMPGFLGTERQFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFL
LRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSAALSEETEKP
KLKATGHVFQALQYLRKLCNHPALVLTPQHPEFKTTTEKLAVQNSSLHDIQHAPKLSALK
QLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGS
IPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRA
HRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTEQLLDLFTL
DKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK
NT seq 5550 nt   +upstreamnt  +downstreamnt
atggcggtttccaggctcgatcgcctttttattttactggatactggcactactcctgtt
acaagaaaagctgctgcacagcaactcggagaagtcgtgaagcttcatccccatgaacta
aataatcttctgtctaaagtgttgatatatttaaggagtgcaaattgggatacccggatc
gcagcaggacaagctgttgaagctatagtgaaaaatatacctgagtggaatccagtgcca
agaaccagacaagaacctacttctgaaagttctatggaagattcacctactacagatcga
ttgaattttgacagatttgatatatgtagattgttacaacatggtgcatcactcctggga
tctgctggtgccgaatttgaagtccaagatgaaaaatcaggcgaagtggatcctaaagag
aggatagcacgccaacgaaaattattacagaagaaacttggccttaatatgggagaagca
attggaatgagtactgaagaacttttcaatgatgaagatttggattataccccaacttca
gcagcccttgtaaacaaacaacctactcttcaggcagctgaattgattgactcagagttt
cgagcaggaatgagcaatagacagaagaacaaagctaaaagaatggcgaagttatttgca
aaacagagatccagggatgcagtggaaactaatgagaagagcaatgatagcactgatggg
gaaccagaagaaaagagacgaaaaatagcaaatgttgtcattaatcagtctgccaatgat
tccaaagtcttgattgataatatttcagacagctcttccttaactgaagagacaaatgaa
tggcctttggaaagcttttgtgaagaactttgcaatgacctttttaatccctcctgggag
gttcgacatggtgccggcactggactaagggaaattcttaaagctcatgggaaaagtggt
ggtaaaatgggtgacagcactttagaagagatgattcagcagcatcaagaatggttggaa
gacttggttattagactcctttgtgtttttgcattagacagatttggagactttgtttct
gatgaagttgtggcaccagttcgtgaaacttgtgctcaaacattaggcgtggttttaaaa
cacatgaatgaaacaggagttcataagactgtggatgtgctgctaaaattacttacacaa
gaacagtgggaagttagacatggtggtttgctgggaataaaatatgctttggcagtccgt
caggatgtaattaatactttattgcctaaagttttaactagaataattgaaggactccag
gatcttgatgatgatgtcagagctgttgctgcagcgtcattagtgcctgtagtagaaagc
cttgtctatcttcagacacaaaaggtacccttcattataaatacattatgggatgctctt
ctggaattagatgatctaacagcttcaacaaatagtattatgactctcctttcatccttg
ctaacttatcctcaggtccaacaatgcagtattcaacagtcactcacagttttagttcca
cgtgtctggccttttttgcatcacactatatcatcagttcgaagagcagcattggaaact
ctgtttacattattatcaacacaggaccagaactcttcatcttggcttatacctatacta
cctgatatgctccgacacatttttcagttttgtgttttggaaagcagccaggacattttg
gaccttattcacaaggtttggatggaactgttaagtaaggcttcagttcagtatgtggta
gcagctgcttgtccatggatgggtgcttggctttgcttaatgatgcagccttctcattta
cctatcgatttaaatatgttgctagaagtaaaagctagagccaaggaaaaaacaggtggt
aagatgcgtcaaggccaaagccagagtaaagaagtacttcaggagtatattgcaggtgcc
gacaccattatggaagacccggccactagggattttgtggttatgcgggccagaatgatg
gcagccaagttgttaggagcactttgttgctgtatttgtgatccaggtgtaaatgtagta
actcaagaaattaaaccagctgaatccctgggccagttactactcttccatttgaactcc
aaatctgctttacagaggattagtgtagctttggtaatctgtgaatgggctgctttacaa
aaggaatgtaaagctgttactttagctgtgcagccacgtttacttgatatcctttcagaa
catttatattatgatgaaattgccgttccattcacacgcatgcagaatgaatgtaaacag
cttatatcatcattagctgatgtacatattgaagttggtaatagagtaaacaacaatgtt
ttaacaatagatcaagctagtgacctggtcactactgtttttaatgaagccacatcatct
ttcgatttaaatcctcaagtgttacagcagctagatagtaaacgacagcaggtccaaatg
accgttacagagaccaaccaggagtggcaagtgttgcagctgagagtgcatacttttgct
gcatgtgcagttgtgagcttgcagcagcttccggagaaattaaatcctatcataaaacca
ttaatggagacaattaagaaagaagagaatacactagtgcaaaactatgcagctcagtgc
atagctaaactacttcagcagtgcacaagaaggacgccctgtcccaattcaaaaattatt
aaaaacctctgtagctcactttgtgtggacccatatctaactccttgtgtcacatgtcca
gtaccaacacaaagtggccaggaaaattctaaaggatccacctcagaaaaagatggaatg
caccatactgtcaccaagcacagaggtataattacactctataggcaccagaaagctgct
tttgctatcacaagtagacgaggtcctacccccaaagcagtaaaagctcaaatagcagat
cttcctgcaggaagtagtggaaatattcttgttgaacttgatgaggcccagaagccttac
ctggtacaacggagaggagctgaatttgctttgacaactatagtaaagcattttggtggt
gaaatggcagtgaagttgccacatctctgggatgccatggttggcccattgaggaataca
atcgacataaacaattttgatggaaaatcccttctggaaaagggcgatggccctgctcaa
gaactggtgaattctctgcaagtttttgaaacagcagcagcttcaatggattctgagcta
catcccttgttggtacagcatttgccacatctttatatgtgccttcagtaccccagtact
gcagtgaggcacatggctgctcgttgtgtaggtatcatgagtaaaatagctaccatggaa
acaatgaatatttttttggagaaggttcttccgtggctgggagcaattaatgacagtgtc
aaacaagagggtgcaattgaagcacttgcctgtgtaatggaacaactggatgttggtatt
gttccatatattgtccttttagttgttcctgtgttgggaagaatgagtgatcagacagac
agcgtgagattcatggcgacgcagtgctttgcaacgctcattagactcatgccacttgag
gcaggcattccagaccctccaaacatgtcagcagaattaatccaattgaaagccaaggag
cgacactttttggagcaattgttagatgggaaaaaattggaaaattataaaattccagta
ccaatcaatgctgaactcagaaaatatcagcaggatggtgtgaactggttagcatttctt
aataaatacaaacttcatggaattctatgtgatgacatgggtttaggaaaaactttacag
tccatctgcattctagcaggagatcattgtcatagggcccaggaatatgcaagatcaaaa
ttggcagaatgtatgccacttccttccttagtggtttgtccgcctacgttaacaggccat
tgggtggatgaagtaggtaaattttgctctaaagaatatctcaatccattgcactacact
ggacctcccactgaaagagtaaggttacagcaccaagtaaaaaggcacaatctaatagtg
gcttcatatgatgttgtgaggaatgacatagatttctttagaaatattaaatttaactac
tgcattcttgatgagggccacgtcatcaaaaatggaaaaacaaagttgtcaaaagcagta
aaacaactgactgctaattacaggattattctttctggaacaccgatccagaacaatgtt
ttggagctgtggtcattatttgatttcctcatgccaggatttttgggtactgaacgccag
tttgctgctcgatatggtaaacctatattagcaagtagggatgctcgaagctccagtcga
gagcaagaagcaggtgttcttgctatggatgcactgcaccgacaagtactgccatttctt
ttgagaagaatgaaagaagatgttctgcaggatcttccacctaaaattattcaagactat
tattgtactcttagtcctctgcaggttcagctctatgaagattttgctaagtctcgtgcc
aagtgtgatgttgatgaaacagtttcttcagctgcactttctgaagaaactgaaaaacca
aagcttaaagctacaggccatgtattccaggcattacagtacttacgtaaactgtgtaac
catccagcattagtcttaacacctcaacatccagaattcaagaccactactgaaaaactg
gcagttcagaattcttctctacatgatatacaacatgcccctaagctctcagctttgaaa
caattgctgttggactgtggtttgggaaatggcagcacttctgagagtggcacagagtct
gttgtggctcagcacaggatactcatcttctgtcagctgaagagcatgcttgatatagta
gagcatgatctcctcaaacctcacttgccctctgtcacttacttgagattagatggcagc
atacctcctggtcagaggcattccattgtttcccggtttaataatgacccatctatagat
gttctgttacttaccactcatgttggtggcctgggacttaatttgacaggcgctgacacg
gtagtatttgtggagcatgactggaatcctatgcgagatctacaagccatggaccgggcc
catcgcattgggcagaaacgggtggttaatgtataccgactgataaccagaggaacattg
gaagaaaaaataatggggttgcagaaattcaagatgaacatagcgaataccgttattagc
caagagaattctagtttgcagagcatggggactgagcagcttcttgatctgtttactctt
gataaggatggcaaagcagaaaaagctgacacctccacttctgggaaagcaagtatgaaa
tcaattcttgaaaacctgagtgatctttgggatcaagagcagtatgattcagagtacagc
ctggaaaattttatgcattctctcaagtaa

DBGET integrated database retrieval system