KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052370
Entry
101052370         CDS       T04350                                 

Gene name
GPN3
Definition
(RefSeq) GPN-loop GTPase 3 isoform X1
  KO
K24104  GPN-loop GTPase
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101052370 (GPN3)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101052370 (GPN3)
SSDB
Motif
Pfam: ATP_bind_1 CLP1_P AAA_30 CbiA AAA_10 ATPase_2 AAA_19 AAA_17 DUF87 AAA_22 AAA_7 FtsK_SpoIIIE SRP54 MeaB KTI12 RNA_helicase AAA_18 AAA_24 AAA_33 AAA_14 AAA_29 Viral_helicase1 RXLR_WY
Other DBs
NCBI-GeneID: 101052370
NCBI-ProteinID: XP_003932302
UniProt: A0A2K6SAT9
Position
Unknown
AA seq 283 aa
MTRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEV
DDVMEDDSLRFGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVM
KQLVQQLEQWEFRVCGVFLVDSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLS
KKAKKEIEKFLDPDMYSLLEDSTSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEES
MNIVLQHIDFAIQYGEDLEFKEPKEREDESSMFDEYFQECQGE
NT seq 852 nt   +upstreamnt  +downstreamnt
atgacccggtatgcgcaactggtcatgggccccgctggcagcgggaagagtacctactgt
gccaccatggtccagcactgtgaagccctcaaccgctctgttcaagttgtaaacctggat
ccagcagcagaacacttcaactactccgtaatggctgacattcgggaactgattgaggtg
gatgacgtaatggaggatgattctctgagattcggtcccaatggaggattggtattttgc
atggagtactttgccaataatttcgactggctagagaactgtcttggccacgtagaagac
gactatatcctttttgattgcccaggtcagattgagttgtacactcacctgcctgtgatg
aaacagctggtccagcagctcgagcagtgggaattccgagtctgtggagtttttcttgtt
gattctcagttcatggtggagtcattcaagtttatttctggcatcttggcagccctgagt
gccatgatctctctagaaattccacaggtcaacatcatgacaaaaatggatctgctgagt
aaaaaagctaaaaaggaaattgagaagtttttagatccagacatgtattctttattagaa
gattctacaagtgacttaagaagcaaaaaattcaagaaactgactaaagctatatgtgga
ctgattgacgactacagcatggttcgatttttaccttacgatcagtcagatgaagaaagt
atgaacattgtattacagcatattgattttgccattcaatacggagaagacctggaattt
aaagaaccaaaggaacgtgaagatgagtcttctatgtttgatgaatattttcaagaatgc
cagggtgaatga

DBGET integrated database retrieval system