KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052442
Entry
101052442         CDS       T04350                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101052442 (AFF3)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101052442 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 101052442
NCBI-ProteinID: XP_010350382
Position
Unknown
AA seq 1233 aa
MKDILNQRNDSLVVEFQSSASRCRSVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLF
SEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFV
ADSRAQTQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLG
DGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSNSGHCVQNFPPSLASKPSLVQQKPTA
YVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAKLSKFSIPKQGEES
RSGENNSCVEEIIREMTWLPPLSAIQAPGKGEPTKFPFPNKDSQLVSSGHNNPKKGDAEP
ESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRASVPSSKGS
SSSSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLN
KVNPHKPPILIQNESHGPESNQYYNPVKDDVQDCGKLPDVCQPSLRDKEIKSTCKEEQRP
RTANKAPGSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPTENAPAPARRSAGKKPTRRTER
TSAGDGANCHRPEEPAAADALGASVVVPPEPTKTRPCGNSRANHRKELRSSVTCEKRRTR
GLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQAVAASASSGNDQRLKEAAA
NGGSGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLT
LLSRIPEHLPQEPGVLSTPATKDSESAPPSHTSDTPAEKTLPKSKRKRKCDIEDNYRETK
KAQGEKESSSRLATSASNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTS
EDLTSSGRPNGNSLFTSASSSKKPKADSQLQPHSGDLMKAAHNNSENIPLHKSRPQTEPW
SPGSNGHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIE
CGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYW
RMFRLKRDHAVKYSKALIDYFKNSSKAAQVPSPWGASGKSTGTPSPMSPNPSPASSVGSQ
GSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLD
LLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3702 nt   +upstreamnt  +downstreamnt
atgaaagacatcttaaaccagaggaatgactctctagttgtggaatttcagtcatcagcc
agcagatgcaggagtgtctatgaaccagatagaaatgcattacggagaaaagaacgggaa
agaagaaatcaagaaactcaacaggatgatggcacgtttaattctagttactctctcttc
agcgagccctacaagactaacaagggggatgaactctctaaccggatccagaacacttta
ggcaattatgatgaaatgaaagactttttaactgatagatccaatcagagtcatcttgtt
ggtgttcccaaacctggggttcctcagactcctgtgaacaagatcgatgaacactttgtt
gcagactcaagagcccagacccagccctcatctatctgtagcactacaacttccacacca
gcagctgtccccgtgcagcagagtaagagaggcaccatgggctggcagaaggctgggcat
ccaccctcagatggccaacagagagcaacacaacagggctctctcaggaccttgcttgga
gatggtgttggcagacagcagccgcgggccaaacaagtgtgcaatgtggaggtgggcctt
cagacccaggagaggccacctgccatggcagccaagcacagcaacagtggacactgtgtt
cagaactttcctccatccctagcttcaaaacccagcctggtccagcagaaaccgactgca
tatgtgcggccgatggatggccaagatcaggcccccgatgagtctcccaagctgaagtca
tcttcggaaaccagtgtgcactgcacatcatacaggggagttcccgccagcaagccggag
ccggccagagccaaggccaagctctccaagttcagcatccccaagcagggggaggagagt
agatctggagaaaacaacagctgtgttgaagaaataatccgggagatgacctggcttcca
ccactttctgctattcaagcacctggcaaaggggaaccaaccaaatttccatttccaaat
aaggactctcagcttgtatcctctggacacaataatccaaagaaaggtgatgcggagcca
gagagtccagacaatggcacgtcgaatacatcaatgctggaagatgaccttaagctaagc
agcgatgaagaggagaatgaacagcaggcagcccagagaacagctctccgtgctctgtct
gacagcgccgtggtccagcagcccaactgcagagcctcagtgccttccagcaagggcagc
agtagcagcagcagcagcggcagcagcagctcctccagcgactcggagagcagctccgga
tccgactcagagaccgagagcagctccagcgagagtgagggcagcaagcccccccacttc
tccagccccgaggctgaaccagcatcttctaacaagtggcagctggataaatggctaaac
aaagttaatccccacaagcctcctattctgatccaaaatgaaagccatgggccagagagc
aatcagtactacaacccagtgaaagacgatgtccaggactgtgggaaacttcccgacgtt
tgccagcccagcctgagggacaaggagatcaagagcacctgcaaggaggagcagaggccg
aggacagcgaacaaggcccctgggagtaaaggcgtgaagcagaagtccccgcccgcggcc
gtggccgtggcggtgagcgcagccgccccgccgcccgcagtgccctgtgcgcccacggag
aacgcgcccgcgcccgcccggaggtcagcgggcaagaagcccaccaggcgcaccgagagg
acctcggccggggacggcgccaactgccaccggcccgaggagcccgcggccgcggacgcg
ctgggggcgagcgtggtggtccccccggaacccaccaaaaccaggccctgcggcaacagc
agagcgaaccaccgcaaggagctgcgctcctccgtgacctgcgagaagcgccgcacacgg
gggctgagcaggatcgtccccaaatccaaggagtttattgagacagagtcatcatcttcg
tcctcctcctcggactccgacctggagtccgagcaggaggagtaccctctgtccaaagca
caggcggtggctgcctccgcctcctccgggaacgaccagaggctgaaggaggctgctgcc
aacgggggcagtggtcccagggcccctgtaggctccatcaacgccaggaccaccagtgac
atcgccaaggagctggaggagcagttctacacgctggtcccctttggccggaacgaactt
ctctcccctctaaaggacagtgatgaggtcaggtctctctgggtcaaaatcgacctgacc
ctcctgtccaggatcccagaacacctgccccaggagccaggggtcttgagcacccctgcc
accaaggactccgagagcgcaccacccagccacacctcggacactcccgcagaaaagact
ttgccaaaatccaagaggaaacgcaagtgtgacatcgaagacaactacagggagaccaag
aaggcccagggagagaaagagagttcttcaagactagccacctccgccagtaatactttg
tctgcaaaccactgcaacatgaacatcaacagcgtggcaataccaataaataaaaatgaa
aaaatgcttcggtcgcccatctcacccctctctgatgcatctaaacacaaatacaccagc
gaggacttaacttcttccggccgacctaatggcaacagtttgttcacttcagcctcttcc
agcaaaaagccgaaggccgacagccagctgcagcctcacagtggagacctcatgaaagca
gctcacaacaattccgaaaacattcccctccacaagtcacggccgcagacggagccgtgg
tctccaggctccaacggccacagggactgcaagagacagaaacttgtcttcgatgatatg
cctcgaagtgcagattattttatgcaagaagctaaacgaatgaagcataaagcagatgca
atggtggaaaagtttggaaaggctttgaactatgctgaagcagccttgtcatttattgag
tgtggaaatgcaatggaacaaggccccatggaatccaaatctccttatacgatgtattca
gaaacagtagagctcatcaggtatgctatgagactaaaaacccactcaggccccaatgcc
acaccagaagacaaacaactggctgcattatgttaccgatgcctggctctcctgtactgg
cggatgtttcgactcaaaagggaccatgctgtaaagtattcaaaagcacttatcgactat
ttcaagaactcatctaaagccgcccaagtcccgtctccgtggggggccagtggaaagagc
actggaaccccatcccccatgtctcccaacccctctcccgccagctccgtggggtctcag
ggcagcctctccaacgccagcgccctgtccccgtcgaccatcgtcagcatcccacagcgc
atccaccagatggcggccaaccacgtcagcatcaccaacagcatcctgcacagctacgac
tactgggagatggccgacaacctggccaaggaaaaccgagaattcttcaacgacttggat
ctgctcatggggccagtcacccttcacagcagcatggagcatctggtccagtactcccaa
cagggcctgcactggctgcggaacagcacccacctgtcatag

DBGET integrated database retrieval system