KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053143Help
Entry
101053143         CDS       T04350                                 

Gene name
ZDHHC20
Definition
(RefSeq) probable palmitoyltransferase ZDHHC20 isoform X3
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101053143 (ZDHHC20)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     101053143 (ZDHHC20)
Membrane trafficking [BR:sbq04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    101053143 (ZDHHC20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Spt4
Motif
Other DBs
NCBI-GeneID: 101053143
NCBI-ProteinID: XP_003919807
Position
Unknown
AA seq 292 aa AA seqDB search
MFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQDILRRAARALPIYTTSASK
TIRYCEKCQLIKPDRAHHCSACDSCVLKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCL
FVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIE
SFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQ
AFVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVRSGV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtatggtcctattggatgacaattttcacatctcccgcttccccctccaaagag
ttctatttatccaattctgaaaaggaacgttatgaaaaagaattcagccaagaaagacaa
caagacattttgagaagagcagcaagagctttacctatctataccacatcagcttcaaaa
actatcagatattgtgaaaaatgtcagctgattaaacctgatcgggcacatcactgctca
gcatgtgactcatgtgttcttaagatggatcatcattgtccttgggtgaataactgtgtg
ggattttctaattacaaattcttcctgctgtttttgttgtattctctattatattgcctt
ttcgtggctgcaacagttttagagtactttataaaattttggacgaatgaactgacagat
acacgtgcaaaattccacgtcctttttcttttctttgtgtctgcaatgttcttcattagc
gtcctctcactttttagctaccactgctggctagttggaaaaaatagaacaacaatagaa
tcattccgcgcacctacattttcatatggacctgatggaaatggtttctctcttggatgc
agtaaaaattggagacaagtctttggtgatgaaaagaaatattggctacttccaatattt
tcaagcttgggtgatggttgcagttttccaactcgccttgtggggatggatccagaacaa
gcttttgttacaaaccagaatgagtatgccagaagtagtggctcaaatcagccttttcct
atcaaaccacttagtgaatcaaaaaaccgcttgttggacagtgaatctcagtggctagag
aatggagctgaagaaggcatcgtcagatcaggtgtatga

DBGET integrated database retrieval system