KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053284Help
Entry
101053284         CDS       T04350                                 

Gene name
NTRK2
Definition
(RefSeq) BDNF/NT-3 growth factors receptor isoform X2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101053284 (NTRK2)
   04010 MAPK signaling pathway
    101053284 (NTRK2)
   04151 PI3K-Akt signaling pathway
    101053284 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101053284 (NTRK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    101053284 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101053284 (NTRK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101053284 (NTRK2)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   101053284 (NTRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Ig_C17orf99 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101053284
NCBI-ProteinID: XP_003941176
UniProt: A0A2K6T4G4
Position
Unknown
AA seq 822 aa AA seqDB search
MSSWIRWHGPAMARLWGFCWLVVGFWRAALACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSADSENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTEDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDVGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggataaggtggcatggacccgccatggcgcggctctggggtttctgctgg
ctggttgtgggcttctggagggccgctctcgcctgtcccacgtcctgcaaatgcagtgcc
tctcggatctggtgcagcgacccttctcctggcatcgtggcatttccgaggttggagcct
aacagtgcagactctgagaacatcaccgaaattttcatcgcaaatcagaaaaggttagaa
atcatcaatgaagatgacgttgaagcttacgtgggactgagaaatctgacaattgtggac
tctggattaaaatttgtagctcataaagcttttctgaaaaacagcaacctgcagcacatc
aattttacccgaaataaactgacgagtttgtctaggaaacacttccgtcaccttgacttg
tctgaactgatcctggtgggcaatccatttacatgctcctgtgacattatgtggatcaag
actctccaagaggctaaatccagtccagacactgaggatttgtactgcctgaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttgccatctgcaaat
ttggccgcacctaacctcactgtggaggaaggaaagtctatcacgttatcctgtagtgtg
gcaggcgatccagttcctaatatgtactgggatgttggtaatctggtttccaaacatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatccgatgacagt
gggaagcaaatctcttgtgtggcagaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtgcattttgcaccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaatattgaatgagtccaaatacatctgtactaagatacacgttaccaatcacacg
gagtaccatggctgcctccagttggataatcccactcacatgaacaatggggactacact
ctcatagcgaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggt
tggcctggaattgatgatggtgcaaacccgaattatcctgatgtaatttatgaagattat
ggaactgcagcaaatgacgtcggggacaccacgaacagaagtaatgaaatcccttccaca
gacgtcactgataaaactggtcgggaacatctctcggtctatgctgtggtggtgattgcg
tctgtggttggattttgccttttggtgatgctgtttctgcttaagttggcaagacactcc
aagtttggcatgaaaggcccagcttccgttatcagcaatgatgatgactctgccagccca
ctccatcatatctccaatgggagtaacaccccatcttcttcagaaggtggcccggatgct
gtcattattggcatgaccaagatccccgtcattgaaaatccccagtactttggcatcacc
aacagtcagctcaagccagacacatttgttcagcacatcaagcgacataacattgttctg
aaaagggagctaggcgaaggagcctttggaaaagtgttcctagctgaatgctataacctc
tgtcctgagcaggacaagatcttggtggcagtgaagaccctgaaggatgccagtgacaat
gcacgcaaggacttccaccgtgaggctgagctgctgaccaacctccagcatgagcacatt
gtcaagttctatggcgtctgcgtggagggcgaccccctcatcatggtcttcgagtacatg
aagcatggggacctcaacaaattcctcagggcacacggccctgacgcagtgctgatggct
gagggcaacccgcccacggagctgacacagtcgcagatgctgcacatagcccagcagatc
gccgcgggcatggtctacttggcatcccagcacttcgtgcaccgagacctggccaccagg
aactgcctggtcggggagaacttgctggtgaaaatcggtgacttcgggatgtcccgggac
gtgtacagcactgactactacagggtcggtggccacacgatgctgcccattcgctggatg
cctccagagagcatcatgtacaggaaattcacgacggaaagtgatgtctggagcctgggg
gttgtgttgtgggagatcttcacctacggcaaacagccctggtaccagctgtcaaacaat
gaggtgatagagtgcatcactcagggccgagtcctgcagcgaccccgcacgtgtccccag
gaggtgtatgagctgatgctggggtgctggcagcgagagccccacatgaggaagaacatc
aagggcatccataccctccttcagaacttggccaaggcatctcctgtctacctggacatt
ctaggctag

DBGET integrated database retrieval system