KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053452
Entry
101053452         CDS       T04350                                 

Definition
(RefSeq) cytochrome c oxidase copper chaperone
  KO
K02260  cytochrome c oxidase assembly protein subunit 17
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00190  Oxidative phosphorylation
sbq01100  Metabolic pathways
sbq04714  Thermogenesis
Module
sbq_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101053452
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101053452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101053452
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    101053452
SSDB
Motif
Pfam: COX17
Other DBs
NCBI-GeneID: 101053452
NCBI-ProteinID: XP_003935461
UniProt: A0A2K6SXN1
Position
Unknown
AA seq 63 aa
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG
FKI
NT seq 192 nt   +upstreamnt  +downstreamnt
atgcccggtctggtcgactcaaatcctgccccgcctgagtctcaggagaagaaaccgctg
aagccctgctgcgcctgcccggagaccaagaaggcgcgcgatgcgtgtatcatcgagaaa
ggagaagaacactgtggacatctaattgaggcccacaaggaatgcatgagagccctagga
tttaaaatatga

DBGET integrated database retrieval system