KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054040
Entry
101054040         CDS       T04350                                 

Gene name
GPN1
Definition
(RefSeq) GPN-loop GTPase 1
  KO
K24104  GPN-loop GTPase
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101054040 (GPN1)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101054040 (GPN1)
SSDB
Motif
Pfam: ATP_bind_1 GTP_EFTU AAA_16 MMR_HSR1 FeoB_N CLP1_P MeaB cobW Arf G-alpha SRP54 SRPRB AAA_24 AAA_33 NTPase_1 AAA_22 SCP_3 NACHT Viral_helicase1 MobB PduV-EutP TsaE DUF87 AAA_30 ABC_tran KAP_NTPase AAA_18 AAA_19 Thymidylate_kin AAA_5 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 101054040
NCBI-ProteinID: XP_003941588
Position
Unknown
AA seq 374 aa
MAALAAAAEPQASGGPRPPVCLLVLGMAGSGKTTFVQRLTGHLHTQGTPPYVINLDPAVH
EVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMQFIEKAQNVSKYVL
IDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKT
KLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRV
VGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQHQREQLERLRKDMG
SVALDAGTAKDSLSPVLDPSELILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNF
MQESMAQYWKRNNK
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcggcgctcgcagctgcagctgagccccaagcctctgggggtccgcggcccccagtg
tgtctgttggtgttaggaatggcgggatccgggaaaaccacctttgtacagaggctcacg
ggacacctgcatacccaaggcactccaccttatgtgatcaacctggatccagcagtacat
gaagttccctttcctgccaatattgatattcgtgacactgtgaagtataaagaagtcatg
aaacaatacggacttgggcccaacggtggcatagtgacctcactcaatctctttgctacc
agatttgatcaggtgatgcaatttattgagaaggcccagaacgtgtctaaatatgtgttg
attgacacacctggacagattgaggtattcacctggtcagcttctgggacaattatcact
gaggctcttgcatcctcatttccaacagttgtcatctatgtaatggacacatcaagaagt
accaacccagtgactttcatgtccaacatgctctatgcctgcagcatcttatacaaaacc
aagctgcctttcattgtggtcatgaataaaactgacatcattgaccacagctttgcagtg
gaatggatgcaggattttgaggctttccaagatgccttgaatcaagagactacatacgtc
agtaacctgactcgttcaatgagcctggtgctggatgagttttatagctcactcagggtg
gtgggtgtctctgctgttctgggtactggattagatgaactctttgtgcaagtcaccagc
gctgctgaagagtatgaaagggagtatcggcctgaatatgaacgtctgaaaaaatcactg
gcaaatgcagagagccagcatcagagagaacaactagaacgccttcgaaaagatatgggt
tctgtagccttggatgcagggactgccaaagacagcttatctcctgtgctggacccttct
gaattgatcctgactcgaggaaccttggatgaagaggatgaggaagcagacagtgatact
gatgacattgaccatagagttacagaggaaagccatgaagagccagcattccagaatttt
atgcaagaatcgatggcacaatactggaaaagaaacaacaaatag

DBGET integrated database retrieval system