KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054087
Entry
101054087         CDS       T04350                                 

Gene name
GTF2I
Definition
(RefSeq) general transcription factor II-I isoform X1
  KO
K03121  transcription initiation factor TFII-I
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03022  Basal transcription factors
sbq04022  cGMP-PKG signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    101054087 (GTF2I)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    101054087 (GTF2I)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101054087 (GTF2I)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101054087 (GTF2I)
SSDB
Motif
Pfam: GTF2I
Other DBs
NCBI-GeneID: 101054087
NCBI-ProteinID: XP_010342926
Position
Unknown
AA seq 799 aa
MVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQAGPSE
TDDVDEKHPVSKPLQGSHHSSEGNEGTEMEVPAEDSTQHVPSETSEDPEVEVTIEDDDYS
PPSKRPKTNELPQPPVPEPANAGKRKVREFNFEKWNARITDLRKQVEELFERKYAQAIKA
KGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLERILLAKERIRFVIKKHELL
NSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAHP
NDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEVTQPRTNTP
VKEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLYVEGLPEGIPFR
SPTWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNS
KVPEIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVEN
LFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKA
KIKFIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASGVEDLNIIQVTIPDDDNERL
SKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMPPGVSFKAPS
YLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQSESEAPVIQESSEPSQLEVPATE
EIKETDGSSQIKQEPDPTW
NT seq 2400 nt   +upstreamnt  +downstreamnt
atggtaacagatgctgacagatcaatactatctccaggtggaagttgtggccccatcaaa
gtgaaaactgaacccacagaagattctggcatttccctggaaatggcagctgtgacggta
aaggaagaatcagaagatcctgattattatcaatataacattcaagcaggcccttctgaa
accgatgatgttgatgaaaaacaccctgtatcgaagcctttgcaaggaagtcatcattct
tcagagggcaacgaaggcacagaaatggaagtaccagcagaagattctactcaacatgtc
ccttcagaaacaagtgaggaccctgaagttgaggtgactattgaagatgatgattattct
ccaccttctaagagaccaaagaccaacgagctaccacagccaccagttccagaacccgcc
aatgcaggaaagcggaaagtcagggagttcaatttcgagaaatggaatgcccgcatcact
gatctgcgtaaacaagttgaagaattgtttgaaaggaaatatgctcaagccataaaagcc
aaaggcccggtgacgatcccataccctcttttccagtctcatgttgaagacctttacgta
gaaggacttcctgaaggaattccttttagaaggccgtctacttacggaattcctcgcctt
gagaggatattacttgcaaaggaaaggattcgttttgtgattaagaaacacgagcttctg
aattcaacacgtgaagatttacagcttgataaaccagcttcaggagtaaaggaagaatgg
tatgccagaatcactaaattaagaaagatggtggatcagcttttctgcaaaaaatttgcg
gaagccttggggagcaccgaagccaaggctgttccttaccaaaaatttgaggcacacccg
aatgatctgtacgtggaaggactaccagaaaacattcctttccgaagcccctcgtggtat
ggaatcccaaggctggaaaaaatcattcaagtgggcaatcgcattaaatttgttattaaa
agaccagaacttctgactcacagtaccactgaagttactcagccacgaacaaacacgcca
gtcaaagaagactggaatgtcagaattaccaagttacggaagcaggtggaagagattttt
aatctgaaatttgctcaagctctgggactcaccgaggcagtgaaagtaccatatcctgtg
tttgaatcgaaccctgagttcctgtatgtagaaggcttgccagagggcatcccctttcga
agccctacctggttcggaattccacgacttgaaaggattgtgcgtgggagtaacaaaatc
aagttcgttgtgaaaaaacctgaactagttatttcctacttgcctcctggaatggctagt
aaaataaacactaaagctttgcagtccccaaaaagaccacgaagtcctgggagtaattca
aaggttcctgaaattgaggtcactgtggaaggccctaataacaacaatcctcaaacctca
gctgttcgaacccctacccagactaacggttctaacgtacccttcaagccgcgaggcaga
gagttttcctttgaggcctggaatgccaaaatcacggacctaaaacagaaagttgaaaat
ctcttcaatgagaaatgcggggaagctcttggccttaagcaagctgtgaaggtgccattc
gcattgtttgagtctttcccagaagacttttatgtggaaggcttacctgagggtgtcccg
ttccgaagaccatctacttttggcattccaaggctggagaagatactcagaaataaagcc
aaaattaagttcatcattaaaaagcccgaaatgtttgagacggcgattaaggagagcact
tcctctaagagtcctcccagaaaaataaattcatcacccaatgttaatactactgcatcg
ggtgttgaagaccttaacatcattcaggtgacaattccagatgatgataatgaaagactc
tcgaaagtggaaaaagccagacagctaagagaacaggtgaatgatctcttcagtcggaaa
tttggtgaagctattggtatgggttttcctgtgaaagtcccctacaggaaaatcacaatt
aaccctggctgtgtggtggttgatggtatgccccctggggtgtccttcaaagcccccagc
tacctggaaatcagctccatgagaaggatcttagattctgccgagtttatcaaattcacg
gtcattagaccatttccaggacttgtgattaataaccagctggttgatcagagtgagtca
gaagcccccgtgatacaagaatcatctgaaccaagccagttggaagttccagccacagaa
gaaataaaagagaccgatggaagctctcagatcaagcaagaaccagaccccacgtggtag

DBGET integrated database retrieval system