KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054362Help
Entry
101054362         CDS       T04350                                 

Gene name
SUCLG1
Definition
(RefSeq) succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X2
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00020  Citrate cycle (TCA cycle)
sbq00640  Propanoate metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
Module
sbq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101054362 (SUCLG1)
   00640 Propanoate metabolism
    101054362 (SUCLG1)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101054362 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101054362 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 101054362
NCBI-ProteinID: XP_003942174
Position
Unknown
AA seq 384 aa AA seqDB search
MKNPPQWEICSGDYCSHPPPPPAFAPVRSPGAWECHWRMTAILAAAVDIATMVSGSSGLA
AARLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALDYGTKL
VGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVC
ITEGIPQQDMVRVKHRLLHQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFIDCLEIFLNDSATEGIILIGEIGGNA
EENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAG
VVVSMSPAQLGTTIYKEFEKRKML
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcctccgcagtgggaaatttgttcaggcgactactgtagccaccctccgcct
cctccggcctttgcccctgttaggtccccgggggcctgggagtgtcattggcggatgacc
gcaattcttgccgccgccgttgacatcgcgaccatggtctccggcagcagcggcttggcc
gccgcccgcctcctgtcgcgcagcttcctcctgccacagaatggaattcggcattgttcc
tatacagcttctcggaaacatctctacgttgataaaaataccaagattatttgccagggt
ttcactggcaaacagggcacctttcacagccagcaggcattggactatggcaccaaactt
gttggaggaaccactccagggaaaggaggccagacgcatctgggcctaccagtctttaac
accgtgaaggaggccaaagaacagacaggagcaacagcttctgtcatttacgttcctcca
ccttttgctgcggctgctattaatgaagctattgaggcggaaattcccttggttgtatgt
atcactgaaggtatcccgcagcaggacatggtacgagttaagcacagattgctgcaccag
ggaaagacaaggctaattgggcccaactgccctggagtcatcaatcctggagaatgtaaa
attggcatcatgcctggtcatattcacaaaaaaggaaggattggcattgtgtccagatct
ggcaccctgacttatgaagcggtccaccaaacaacgcaggttggattggggcagtctttg
tgcgttggcattggaggtgatccttttaatggaacagattttattgactgccttgaaatc
tttttgaacgattctgccacagaaggcatcatattgattggtgaaattggtgggaatgcc
gaagagaatgctgcagaatttttgaagcaacataattcaggtccaaattccaaacctgta
gtgtccttcattgctggtttaactgctcctcctgggaggcgaatgggtcatgcaggagca
attattgctggaggaaaaggtggagctaaagagaagatctctgcccttcagagtgcagga
gttgtggtcagtatgtctcctgcacagctgggaaccaccatctacaaggaatttgaaaag
aggaagatgctatga

DBGET integrated database retrieval system