KEGG   Fretibacterium fastidiosum: SY1_03470Help
Entry
SY1_03470         CDS       T02602                                 

Definition
(GenBank) phosphatidylserine decarboxylase precursor-related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
sbr  Fretibacterium fastidiosum
Pathway
sbr00564  Glycerophospholipid metabolism
sbr01100  Metabolic pathways
sbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SY1_03470
Enzymes [BR:sbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SY1_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CBL27831
UniProt: D4M7I6
Position
386328..386948
Genome map
AA seq 206 aa AA seqDB search
MRFARDGFFTIAASVLLTAFAALFSLALGAAMGAFTLFVLWFFRDPDRSTPDRENAFFSP
ADGRVVEILEVEHPFTGPAVRVGVFMNVFSVHVNRAPCAGQVAFLDYVPGKKVAAFAAKA
SEVNERNFVGLSTPRGPVMMVQIAGLLARRIVCRLKLGDVLEAGQRYGMIRLGSRVDIYL
PREVRLTVKIGDKVYAGVSLIGEVER
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgccagagacgggttcttcacgattgcggcctccgtcctgctgacggcgttt
gccgcccttttctccctcgccctgggggcggcgatgggggcgttcacgctcttcgtcctt
tggttcttccgcgacccggaccgcagcacgccggatcgggaaaacgcctttttctccccg
gcggacgggcgcgtcgttgagattttggaggtcgagcaccccttcacggggcccgccgtc
cgggtgggggtcttcatgaacgttttcagcgtccacgtgaaccgggccccctgcgcgggg
caggtggcttttctggactacgttccgggaaagaaggtcgctgccttcgccgcgaaggcc
tccgaggtcaacgagcgcaacttcgtcggcctctcgacgccccgtggtccggtcatgatg
gtgcagatcgcgggactgcttgcgcggcgcatcgtctgtcgcctgaagctgggtgacgtc
ctggaggcggggcagcgctatgggatgattcgcctggggtccagagttgacatctacctt
cccagggaggtaagattgacagtcaagattggagataaggtgtatgccggagtctccctc
ataggagaggtggaacgatga

DBGET integrated database retrieval system