KEGG   Shewanella baltica OS117: Sbal117_0021Help
Entry
Sbal117_0021      CDS       T02013                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00071  Fatty acid degradation
sbs00280  Valine, leucine and isoleucine degradation
sbs00281  Geraniol degradation
sbs00310  Lysine degradation
sbs00362  Benzoate degradation
sbs00380  Tryptophan metabolism
sbs00410  beta-Alanine metabolism
sbs00640  Propanoate metabolism
sbs00650  Butanoate metabolism
sbs00903  Limonene and pinene degradation
sbs00930  Caprolactam degradation
sbs01040  Biosynthesis of unsaturated fatty acids
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01130  Biosynthesis of antibiotics
sbs01200  Carbon metabolism
sbs01212  Fatty acid metabolism
Module
sbs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sbal117_0021
   00650 Butanoate metabolism
    Sbal117_0021
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal117_0021
   01040 Biosynthesis of unsaturated fatty acids
    Sbal117_0021
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal117_0021
   00310 Lysine degradation
    Sbal117_0021
   00380 Tryptophan metabolism
    Sbal117_0021
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal117_0021
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sbal117_0021
   00281 Geraniol degradation
    Sbal117_0021
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal117_0021
   00930 Caprolactam degradation
    Sbal117_0021
Enzymes [BR:sbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sbal117_0021
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sbal117_0021
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sbal117_0021
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Sbal117_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEH11827
Position
complement(23374..25524)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLTSLDAALDSIKQDSNIKALVLTSS
KDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRAEDALK
VGAVDAVVAPQALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGMV
FAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQFVK
GKAKKAGKLAKEVNNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAAKLL
SAQVARGRSTPEKMAKVLNNITPSLDYAAIKHSDVVVEAVVEHPKIKAQVLAEVEGYVSE
DAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEIIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSRGKP
KKDVDPTSYGLLKDAFGELKAFEADDIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaggttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgacagagaaaccctcacctcgctcgat
gcggcattagacagcatcaagcaagattctaatatcaaagcgttagtgctgacctcaagt
aaagatacctttattgtgggcgccgacattaccgaatttttaggcctgttcgcacaagat
gacgccgtattgctctcttgggttgaacaagctaacgcagtcttcaacaaactcgaagac
ttgcctttcccaaccgcatcagcaatcaaaggctttgccttaggtggcggctgtgaaacc
attctggcaaccgatttccgcatcgcagacaccacagccaaaatcggtttacctgaaact
aaactcggcatcatcccaggctttggcggcacagttcgtctgccacgtgtgattggtgca
gataacgcacttgagtggattaccacaggtaaagaccaacgcgctgaagatgcactgaaa
gtcggcgctgttgatgccgtggttgcaccacaagcgttagaagctgctgcgattcaaatg
ctgaaagatgctgttgctgaaaagctggattggcaagcacgtcgtaaccgtaaactgtct
gcactaacactgccaaaacttgaagctatgatgtcattcaccacagccaaaggcatggtg
tttgcggttgcgggtaaacactaccctgcaccaatggctgcagtaagcgtgattgagcaa
gcatcgactaaaggtcgtgctgaagcattacaaatcgaacatcaagcctttatcaagcta
gcgaaaaccgacgttgctaaggcacttatcggtattttccttaatgatcaatttgttaaa
ggtaaagcgaagaaagccggcaagttagcgaaagaagtcaacaacgcggccgtattaggc
gcaggcattatgggcggcggcatcgcttaccaaagcgccagcaaaggcacaccgattgtc
atgaaagacattgcccagccagcattagatttaggcctcaatgaagccgctaaactgttg
tctgcccaagtcgcccgtggccgttcaacgccagaaaaaatggccaaagtgctgaacaac
atcacgccttcgttagattatgccgcgattaaacacagtgatgttgtcgttgaagccgtt
gttgaacatccaaaaatcaaagcacaggttttagccgaagttgaaggctatgtgagtgaa
gatgcaattatcgcgtcaaacacttcaacaatttcaatcaacttgctcgctaagagcatg
aagaaacctgagcgtttctgcggtatgcatttcttcaacccagtgcacaaaatgccgttg
gtcgaaattatccgtggcgaacacagctctgaagaaaccatcgcctctgttgtggcttat
gccagcaaaatgggcaagaccccaatcgttgttaatgattgccccggcttcttcgttaac
cgcgtactcttcccttactttgcaggctttaacggcttacttgccgaaggtggcgacttt
gctgcaatcgacaaagtgatggaaaaacaattcggttggccaatgggtccagcttacctg
ctcgacgtagtaggtttagacacaggtcatcacgcccaagctgtaatggctgaaggtttc
cctgatcgcatgggtaaatctggtactgacgcgattgatgtgatgtttgagaacaaacgt
cttggccagaaaaatggcaaaggtttctatgtctattcagtcgatagccgtggcaagccg
aagaaagatgtcgatccaacaagctacggtctattgaaagatgcctttggcgagttaaaa
gcctttgaagccgatgacattattgctcgtactatgatccctatgatcatcgaaaccgtg
cgctgtttagaagaaggtattgtcgcatcgcctgccgaagcggatatgggcctagtttat
ggcttaggtttcccgccattcagaggcggcgtattccgttacttggataccatgggtgtc
gcaaattttgtggccttagcagacaaatacgctcacttgggcggtctgtatcaagtcaca
gatgcgatgcgcacattagcagccaataacggtagctactaccaagcctaa

DBGET integrated database retrieval system