KEGG   Shewanella baltica OS117: Sbal117_0104Help
Entry
Sbal117_0104      CDS       T02013                                 

Definition
(GenBank) Malate synthase family protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00620  Pyruvate metabolism
sbs00630  Glyoxylate and dicarboxylate metabolism
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01200  Carbon metabolism
Module
sbs_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal117_0104
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal117_0104
Enzymes [BR:sbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal117_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2431
Motif
Other DBs
NCBI-ProteinID: AEH11907
Position
complement(118208..118771)
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRSGMIGA
RDVANLEDIQIGTSLNMVVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtgaatgtcgccgagcacgagaagatcgctaatgcg
aaacaattcctcgaccgcctctttccacttaactctggttcacaccaagatgtgagcagc
tatgtggtttactaccaacacctgttggccttttttgccgacggcagccacagtggttta
cgtcagccaaaacagtttgtggcctttaacggcactaaagatgcgccttgcgccatagtg
ttacaggacctaggttgccacgttgaactcagtttcgaccgcagtggcatgataggtgcg
agagacgttgccaatctggaagatatccaaatcggaacgtcattaaacatggtagtcgga
acaccagagtcacgttctgccgcatcgcgccattggctcagcctattacatgcgggaatg
tccagcgccaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system