KEGG   Shewanella baltica OS117: Sbal117_1605Help
Entry
Sbal117_1605      CDS       T02013                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00071  Fatty acid degradation
sbs00072  Synthesis and degradation of ketone bodies
sbs00280  Valine, leucine and isoleucine degradation
sbs00310  Lysine degradation
sbs00362  Benzoate degradation
sbs00380  Tryptophan metabolism
sbs00620  Pyruvate metabolism
sbs00630  Glyoxylate and dicarboxylate metabolism
sbs00640  Propanoate metabolism
sbs00650  Butanoate metabolism
sbs00900  Terpenoid backbone biosynthesis
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01130  Biosynthesis of antibiotics
sbs01200  Carbon metabolism
sbs01212  Fatty acid metabolism
sbs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal117_1605
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal117_1605
   00640 Propanoate metabolism
    Sbal117_1605
   00650 Butanoate metabolism
    Sbal117_1605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sbal117_1605
   00072 Synthesis and degradation of ketone bodies
    Sbal117_1605
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal117_1605
   00310 Lysine degradation
    Sbal117_1605
   00380 Tryptophan metabolism
    Sbal117_1605
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal117_1605
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal117_1605
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sbal117_1605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbs04147]
    Sbal117_1605
Enzymes [BR:sbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sbal117_1605
Exosome [BR:sbs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal117_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEH13364
Position
1838771..1839961
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQDIVIVAAKRTPMGGFQGNLSSVASPMLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKTEITPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLTSRGEADRLGLAVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDIAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagatatcgttattgttgctgctaaacgcaccccaatg
ggcgggtttcaaggcaacttatcatccgtagcatcacccatgttagccgcgacggccatt
aaaggcttgttagcggaaacacaattggcgggtgagcatgttgatgaagtcttgatgggc
tgcgtattacccgcaggcttaggtcaagcgcctgcgcgtcaggcaactttgggtgcggga
ttacccttatccgttggtgcgaccacagtgaacaaggtctgtggctcaggcatgaagacg
gtaatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgatcgcaggcggc
atggaaagtatgagccaagcgccgtatttactcgacaaagcccgcggcggtatgcgcatg
ggccatggaaaagtgttagatcacatgtttttagatggtcttgaagatgcctacacgggt
ggtgctatgggaacgtttgcccagaaaacggccgatgaatttggtatcacccgcgagcag
atggacgcttttgccttaagctcgcttgaaaaagccaatgccgcgattaactcgggtgcc
tttaaaaccgaaatcacgcccgtcacagtcagtgatcgtcgtggtgatgtgactatcgat
accgacgagcaacccggtaatgcccgccctgaaaaaattcctacactgcgcccagccttt
actaaagatggcactatcacagcggcaaactctagctctatttccgatggcgcagcggca
ttaatgctgacctcacgcggcgaagctgaccgtttaggcttagccgtgttagccaccatt
aaaggccacacgactcacgcccaagagccttcattgttcaccactgcaccggttggcgct
atggcgaaattgctggccaatgtcggttggtcaacggacgaggtggatttattcgaaatc
aacgaagccttcgcgatggtgactatgcttgccgtgtctgagctaggtttagatatcgct
aaggttaacgtcaatggcggcgcctgcgccttaggccatcctattggttgctcaggttca
cgtttgctggtgaccttaattcatgcattaaaagcccgcggccttaagcgcggtgtcgcc
tcgctgtgtatcggcggtggtgaagcgacggcgatggcgattgaggtttaa

DBGET integrated database retrieval system