KEGG   Shewanella baltica OS117: Sbal117_2651Help
Entry
Sbal117_2651      CDS       T02013                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00020  Citrate cycle (TCA cycle)
sbs00310  Lysine degradation
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01130  Biosynthesis of antibiotics
sbs01200  Carbon metabolism
Module
sbs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal117_2651
  Amino acid metabolism
   00310 Lysine degradation
    Sbal117_2651
Enzymes [BR:sbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sbal117_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEH14357
Position
complement(3033816..3035006)
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FEEGATVLGEQVIAKFIAGAVSGKEVTKAQAEAATPAAETSNESSDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVKSAPKAAAPAAPAVAPLAAGRSEKRVPMTRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRDLALKGRDG
KLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgccacgattgcc
acttggcatgtgaaagtgggcgagcaagtttctcgtgatcaaaacctggttgatattgaa
accgataaagtggttcttgaagtggttgcgccagaagatggccacattggcgagtttttg
tttgaagaaggcgccactgttctgggtgaacaagtgatcgctaaattcatcgccggtgct
gtatcgggcaaagaagtcactaaagcgcaagctgaagcggctacgcctgcagctgaaacc
agcaatgaaagcagtgatgcgttaagcccatctgtacgccgtttactggctgagcacaat
gttgatgccagcaaagtaaaaggcactggtgtgggtggtcgtattactaaagaagacgtt
gaagcttttgttaagtctgcgcctaaagctgcggcgccagcagcacctgctgtggctcca
ttagcggctggccgtagcgagaagcgcgtgccaatgacacgtctgcgtaagacaatcgct
aaccgcttgttagaagcgaaaaactctaccgctatgctcaccacgtttaacgaagtgaac
atgaagccaatcatggatatccgtaagcaataccaagatatctttgaaaagcgtcacggt
atccgtttaggctttatgtctttctacattaaagccgtgactgaagcgctgaaacgtttc
ccagaagtcaacgcgtctattgatggcgatgatatcgtttatcacaactacttcgacatc
agcatcgcagtatcaacgccacgtggtctggtaacaccagtgttacgtgacactgatacc
atgaacttagctgaaatcgaaaaagctgtccgtgacttagcccttaaaggccgtgacggt
aagctgactgtggctgacatgactggcggtaacttcactgtgactaacggtggcgttttc
ggttcattgatgtctacaccgattcttaacctgccacaaagcgcgattttaggcatgcat
gccattaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatgtac
ctggcactctcatatgaccatcgtattgttgatggccgtgagtctgttggtttcttggtg
gcgattaaagacttcctagaagacccaactcgtctgctgcttgatctgtaa

DBGET integrated database retrieval system