KEGG   Shewanella baltica OS117: Sbal117_2806Help
Entry
Sbal117_2806      CDS       T02013                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00430  Taurine and hypotaurine metabolism
sbs00620  Pyruvate metabolism
sbs00640  Propanoate metabolism
sbs00680  Methane metabolism
sbs01100  Metabolic pathways
sbs01120  Microbial metabolism in diverse environments
sbs01200  Carbon metabolism
Module
sbs_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal117_2806
   00640 Propanoate metabolism
    Sbal117_2806
  09102 Energy metabolism
   00680 Methane metabolism
    Sbal117_2806
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Sbal117_2806
Enzymes [BR:sbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Sbal117_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEH14502
Position
3233386..3234585
Genome map
AA seq 399 aa AA seqDB search
MSNNLVLVLNCGSSSLKFAVIDAQTGDDQISGLAECFGLEDSRIKWKINGEKHEAALGAF
TAHREAVEYIVNKILAEQPELAAKIQAVGHRIVHGGEKFTRSVIIDESVIKGIEDCASLA
PLHNPAHLIGIRAAIASFPKLPQVAVFDTAFHQSMPDRAYVYALPYKLYREHGIRRYGMH
GTSHLFVSREAAKMLNKPIEETNVICAHLGNGASVTAIKGGKSVDTSMGLTPLEGLVMGT
RCGDIDPSIIYHLVHQLGYTLEEVNNLMNKQSGLLGISELTNDCRGIEEGYADGHKGATL
ALEIFCYRLAKYIASYTVPLGRLDAVVFTGGIGENSDLIREKVLNMLEIFNFHVDSERNK
AARFGKKGIITQDKGTIAMVIPTNEEWVIAEDSIKLINK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataatctggttttagttctcaattgcggtagctcttctctcaaatttgccgtc
attgacgcgcaaacaggtgacgatcaaatttctggcttagccgaatgttttggtttagaa
gactcgcgcattaaatggaaaatcaacggcgaaaaacatgaagcggccttaggcgcattt
acggctcaccgtgaagcagttgaatacattgttaataaaatccttgcggaacagcctgaa
ttagcagcgaaaattcaagccgttggccaccgtatcgttcacggcggagaaaagttcact
cgttctgtgatcatcgacgaaagcgtgatcaaaggtatcgaagattgtgcttcattagcc
cccctgcacaatcctgctcaccttatcggcatccgtgcagccattgcctctttccctaaa
ttgccacaggttgccgtattcgataccgcattccaccaaagcatgcctgacagagcctat
gtctacgccctgccttacaagttataccgtgaacacggtatccgtcgttatggcatgcat
ggcacgagccatttattcgttagccgtgaagcggcaaaaatgcttaacaagcccattgaa
gaaactaacgttatctgtgctcacttgggcaacggcgcgtcagtgactgccatcaaaggc
ggcaaaagtgtcgacacttctatgggcttaaccccattagaaggtttggtcatgggcaca
cgttgtggcgatattgacccttcaatcatctatcacttagttcaccaactgggttacacc
ttagaagaagtgaataacctgatgaacaagcaaagtggtctgctggggatttccgagctg
actaacgattgccgcggtatcgaagaaggttacgccgacggccataaaggcgcgacctta
gccttagaaattttctgctaccgtttagccaaatacatcgcctcttacactgtgccactg
ggccgtttagatgcagtcgtcttcaccggcggcattggcgaaaactcagacttaatccgc
gaaaaagtgctcaacatgctggaaatcttcaatttccatgtcgatagcgaacgcaacaaa
gcggcgcgtttcggtaagaaaggcatcatcactcaagataaaggcacgattgccatggtg
atcccaacgaacgaagaatgggtaatcgccgaagattcaattaaactgatcaacaaataa

DBGET integrated database retrieval system