KEGG   Shewanella baltica OS117: Sbal117_2833Help
Entry
Sbal117_2833      CDS       T02013                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
sbs  Shewanella baltica OS117
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sbal117_2833
Enzymes [BR:sbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Sbal117_2833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AEH14527
Position
complement(3263203..3264111)
Genome map
AA seq 302 aa AA seqDB search
MRDSSAFINKFTYNSPMNTQSILADLHSHTTASDGQLTPSELVARALGKGVQLFAITDHD
TVAGLPEARAFNLSQAKPLKLISGVEISTRWNSYDIHIVALNFDADNPALLAFLENQREL
RELRAQEIGHRLAKAGIEGAYEGAKALAGEAALSRGHYARWMAENGHAVDMPSVFKRYLA
RGKTGYVPNNWGDMASAIDIIHNAGGLAVLAHPSGYKLSAKWLKRLVREYKEAGGDAMEV
VLGQQTLDDRANLVALSLQNQLLASIGSDFHFPSNWIELGKNLYQPQGIDWVWQSESWVE
RP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatagcagcgcatttattaacaaattcacgtacaatagccccatgaatactcaa
agcatattggctgatctgcacagccacacgaccgcatccgacggtcagttaactccgtct
gaattggtggctagagcccttggaaagggtgtgcagttatttgcgattactgaccacgac
acggtagcaggtttacccgaagcccgtgcctttaatctatcgcaagcaaaaccattgaaa
ttgatctctggcgtagaaatctctactcgctggaacagttatgatatccacatcgttgcg
cttaacttcgatgcagataatcctgcgttattagcatttttagaaaaccagcgtgagtta
cgtgaattacgcgcccaagaaattggtcatagattagccaaggccggtattgaaggcgct
tacgaaggtgccaaggcgttggcgggagaagcggcattgagtcgtggacattacgcccgc
tggatggctgaaaatggtcatgctgtggatatgccgagcgtgtttaaacgctaccttgcc
cgcggtaaaaccggttatgtccccaataattggggtgatatggccagcgccatcgatatc
attcataacgcgggtggattagctgtgttggcgcatcccagtggttataagttatcggca
aagtggcttaagcgcttagtgcgcgaatataaagaagcgggtggagatgccatggaagtg
gtacttggccagcaaacattagacgacagggccaaccttgtggccttgagcttacaaaat
caattacttgcatcgatagggagtgattttcactttccaagtaattggatcgaattaggt
aaaaatctgtatcagccccaaggtattgattgggtctggcaatcggaatcttgggtggaa
cgaccatga

DBGET integrated database retrieval system