KEGG   Shewanella baltica OS117: Sbal117_3151Help
Entry
Sbal117_3151      CDS       T02013                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00260  Glycine, serine and threonine metabolism
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01130  Biosynthesis of antibiotics
sbs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal117_3151
Enzymes [BR:sbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Sbal117_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AEH14837
Position
complement(3634543..3635556)
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTQPTAAMRLAMSRAEVGDDVYGDDPTVNSLQDMAAEMFGFESALFTCSGTQ
ANLLALMAHCERGDEYLCGQQAHNYKFEGGGAAVLGSIQPQPLLNQVDGTIALADIEAAI
KPDDIHFARTRLLSLENTIGGKVIPQSYLADAQALAFHRGLKIHLDGARVANAAVAQNIA
ISEITAHFDSVSICLSKGLCAPVGSLLLGDERLIKKAIRWRKMLGGGMRQAGILAAAGKL
ALTEQVQRLSEDHDNAAYLARQLAELSEFDVDLAAVQTNMLFAKLAPKVDADLLAKHCRA
EGILISPGRTIRLVTHKDVSRQDIDKVLRVMKQHFTA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttacgcagtgatactgttacccagccaacagcagcgatgcgattagccatg
tccagagccgaagtaggtgacgatgtttacggtgatgatcccacggtaaatagtttgcag
gatatggccgcagagatgtttggctttgaaagcgcattatttacctgttcaggtacgcag
gcgaatttattggctttgatggcccactgtgagcgtggtgatgagtatctgtgcggccag
caggcccacaattataaatttgagggtggcggtgccgctgtcttaggcagcattcaacct
caacctttgttgaatcaagtcgatggcaccattgccttggccgatattgaagccgctatt
aagcctgacgatatccattttgcccgcacacgtttgctcagtttagagaatacaattggc
ggtaaagtgattccgcaaagctatttagcggacgcgcaggcattggcctttcatcgcgga
ttaaaaatccatctcgacggcgcgcgagttgctaatgcggctgtggcgcagaatatcgcg
ataagtgagattacggcgcattttgattctgtgtcgatttgtctgtccaaagggttatgc
gcgccagttggctcattactcttaggtgacgagcgtttgattaagaaagcgattcgctgg
cgtaaaatgctcggtggcggtatgcgtcaagctgggatacttgctgcggcaggtaagctc
gccttaactgagcaagtgcaacgactgagtgaagatcatgacaacgcggcgtatttggct
cgtcagttggccgagttgagcgagttcgacgtcgatttagccgcagtacaaaccaatatg
ttatttgccaaattagcgcctaaagttgatgcggatttattggcgaaacactgtcgagct
gaaggcattctaataagccctgggcgcacgattcggcttgtgactcacaaagatgtgagc
cgtcaggacatagataaagtgttgcgggttatgaagcagcacttcaccgcctaa

DBGET integrated database retrieval system