KEGG   Shewanella baltica OS117: Sbal117_4071Help
Entry
Sbal117_4071      CDS       T02013                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbs  Shewanella baltica OS117
Pathway
sbs00010  Glycolysis / Gluconeogenesis
sbs00020  Citrate cycle (TCA cycle)
sbs00620  Pyruvate metabolism
sbs01100  Metabolic pathways
sbs01110  Biosynthesis of secondary metabolites
sbs01120  Microbial metabolism in diverse environments
sbs01130  Biosynthesis of antibiotics
sbs01200  Carbon metabolism
Module
sbs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal117_4071
   00020 Citrate cycle (TCA cycle)
    Sbal117_4071
   00620 Pyruvate metabolism
    Sbal117_4071
Enzymes [BR:sbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sbal117_4071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RnfC_N PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEH15729
Position
complement(4703512..4705503)
Genome map
AA seq 663 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICVAVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAAAPAPVAAPAQAAPASAPVQAAPAPVAAATGATKVVE
VTVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKDVKVAVGD
KVSQGSLVIMLEVGGAAPVAAPTVAAQAAPAATVTPVAAAPAAPAASVVAVKEIQVPDIG
DASNVDVIEVLVSVGDEITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKVSQGSV
IATIETVTAGAAPAPVAQAAAPAPVSAAPIAAPTPASRPPVPHHPSAGTPVSTGAVHASP
AVRRLAREFGVDLTQVAGTGRKGRIMKEDVQAYVKYELSRPKATAATSVGSGNGGGLQVI
AAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRKQQNDV
AAKKKADYKITPLVFMLKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVDTPNGLV
VPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFTPIVNY
PDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGILSDIRT
LVL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtgcaagtgatc
gaaatttgtgtggctgtgggtgataccctagcggcagaagaatcgattcttaccgtcgaa
agcgacaaggcgactatggatattccagcgcctttcgccggtgttttagccgaattgaaa
gtggctgtgggcgataaagtatctgaaggtactttgattgctatgatgcaagcagcgggc
gcggcagctgctgctccggctccagttgcagcacccgctcaggcggcaccagcatctgca
ccagttcaagcggctcctgccccagtggctgctgcgacgggcgcaaccaaagtggttgaa
gtgactgtacctgatatcggtggcgacactgatgtgtcggttatcgaagtcctggttgct
gttggtgacaagattgaagttgatagcggtttaattaccctagaaacagacaaagcgacc
atggacgtaccatcacctttcgcgggtgtggttaaagacgttaaagtcgcagttggcgat
aaagtgtcgcaaggctctttagtcatcatgcttgaagtgggcggcgctgcacctgtagcc
gcgccaactgttgctgcccaagcggctcctgccgctacggtaacgccagtggccgcagca
cctgctgcaccagcggcaagtgtggttgcggtaaaagaaattcaagtgccggatattggc
gatgccagcaatgtcgatgtgatcgaagtgctcgtgtctgttggtgatgaaatcactgct
gaccaaggtttgattacccttgaaactgacaaagccaccatggaagtgcctgcgccattc
gccggtaaactgctgtctttgactgttaaagtgggtgacaaggtttctcaaggtagcgtt
attgcgacgattgaaactgtgactgcaggtgcagctcctgcgcctgttgctcaagcggca
gctcctgctccagtgagcgcggcgcccattgcagccccaacacctgcaagccgtcctcca
gtgccacaccacccaagcgcaggtacgcctgtgtctaccggtgcggtacatgcgtctcct
gcggtacgtcgtttagcccgtgaatttggtgtcgacttgacccaagttgctggtactggc
cgtaaaggtcgcatcatgaaagaagacgtacaggcgtatgtgaaatacgaactgtctcgt
ccgaaagcgactgcggcaacctctgttggttcaggtaacggcggcggtctgcaagtgatt
gcagcacctaaagttgatttcagtaagtttggtgaagtggaagagattccattaagccgt
atccagaagatttcaggtcctaacttacaccgcaactgggtaactatccctcacgtgact
cagttcgatgaagctgatatcactgaaatggaagagttccgtaagcagcaaaacgatgta
gcggcgaagaaaaaagccgattacaagatcacgcctttagtgtttatgctaaaagctgtg
gctaaaacgttgcaacagttcccagtgttcaactcaagcttaagtagcgatggcgaatca
ctgatccagaagaagtatttccatatcggtgtggcggtagatacgccaaacggtttggtt
gtgccagtcgtgcgtgacgtggataagaaaggcattatcgagttatctcgtgaactggct
gatatctctatccgtgcccgtgatggcaagctgaaatctgctgacatgcaaggtagctgt
tttactatttcaagtttaggtggcattggcggtacagcgtttacgcctatcgttaactac
ccagacgtggcgattttaggtgtgtctaaatctgaaattaagcctaagtggaatggtaaa
gagttcgaacctaaattgatgttgccattgtcgctgtcatacgatcaccgcgtgatcgat
ggtgctatggctgcacgctttagtgtgacgctgtcaggaattctgtccgatattcgtact
ttggttctgtaa

DBGET integrated database retrieval system