KEGG   Shewanella baltica OS678: Sbal678_1508Help
Entry
Sbal678_1508      CDS       T01725                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sbt  Shewanella baltica OS678
Brite
KEGG Orthology (KO) [BR:sbt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbt03016]
    Sbal678_1508
Enzymes [BR:sbt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Sbal678_1508
Transfer RNA biogenesis [BR:sbt03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Sbal678_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADT93683
Position
1773010..1773873
Genome map
AA seq 287 aa AA seqDB search
MNQDDIWLETPENALNASQEDDSEEQAPEIEILYEDEHLVAIHKPAGLLVHRSYLARRER
FFAMQLTRDLVGCHVFPVHRLDRPTSGVLLFAKSSEVANALCEQFASHTIEKQYLALVRG
NMHESGILDYALKVELDELGDKNADPNKAAQEAVTAYEPLLNTEIPYPSGRYPTSRFALV
RLSPKTGRKHQLRRHMAHLRHPIVGDTTHGDGKQNAFFREHFGINRLWLIAKKLSFTHPV
TQVRLSIETELEPQWETVFAELGWDEATLSQQAELLIATDEIPAGNA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagatgatatctggcttgaaacgcctgaaaatgcactgaatgcatcccaagag
gatgactcagaagagcaggcgcctgagattgaaattctttatgaagatgagcacttagtg
gcaattcataaacctgcaggcttattggtccaccgcagttatttagcgcgtcgggagcga
ttttttgccatgcagctgacccgcgacttagtcggctgtcatgtgttccctgttcatcgt
ctcgacaggccgacatctggcgtgcttttgtttgccaagagcagcgaagtcgccaatgca
ctgtgtgagcaatttgcctcccatacgattgaaaaacaatatttggctttagtgcgcggc
aatatgcatgagagcggtattttagactatgcgcttaaggttgagttggatgaattaggc
gataagaatgccgatcccaacaaagccgcgcaggaagctgtgacggcttatgagccatta
ctcaatactgaaattccgtatccctcgggccgatatcccactagccgatttgcactggta
cgcttgagccctaaaacggggcgtaagcatcagcttagaagacatatggcgcatttacgt
caccctattgtcggtgataccacccatggtgacggtaagcaaaatgcgtttttccgcgag
cattttggcattaatcgcctgtggcttatcgcgaaaaagctcagcttcacccatccagtg
actcaagttcggctcagtatagaaactgagctcgagcctcagtgggaaaccgtgtttgcc
gagctaggttgggacgaggcgaccttaagtcaacaggctgagttgttaatcgccacggat
gaaataccagctggaaatgcgtaa

DBGET integrated database retrieval system