KEGG   Shewanella baltica OS678: Sbal678_1562Help
Entry
Sbal678_1562      CDS       T01725                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00071  Fatty acid degradation
sbt00072  Synthesis and degradation of ketone bodies
sbt00280  Valine, leucine and isoleucine degradation
sbt00310  Lysine degradation
sbt00362  Benzoate degradation
sbt00380  Tryptophan metabolism
sbt00620  Pyruvate metabolism
sbt00630  Glyoxylate and dicarboxylate metabolism
sbt00640  Propanoate metabolism
sbt00650  Butanoate metabolism
sbt00900  Terpenoid backbone biosynthesis
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
sbt01130  Biosynthesis of antibiotics
sbt01200  Carbon metabolism
sbt01212  Fatty acid metabolism
sbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal678_1562
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal678_1562
   00640 Propanoate metabolism
    Sbal678_1562
   00650 Butanoate metabolism
    Sbal678_1562
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sbal678_1562
   00072 Synthesis and degradation of ketone bodies
    Sbal678_1562
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal678_1562
   00310 Lysine degradation
    Sbal678_1562
   00380 Tryptophan metabolism
    Sbal678_1562
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal678_1562
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal678_1562
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sbal678_1562
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbt04147]
    Sbal678_1562
Enzymes [BR:sbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sbal678_1562
Exosome [BR:sbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal678_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADT93737
Position
1837329..1838519
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQDIVIVAAKRTPMGGFQGNLSSVASPMLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKAEITPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLTSRGEADRLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDIAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagatatcgttatcgttgccgctaaacgcaccccaatg
ggcgggtttcaaggcaacttgtcatccgtagcatcacccatgttagctgcgacggccatt
aaaggcttgttagcggaaacacaattggcgggtgagcatgttgatgaagtcttgatgggc
tgcgtattacccgcaggcttaggtcaagcgcctgcgcgtcaggcaactttgggtgcggga
ttacccttatccgttggtgcgaccacagtgaacaaggtctgtggctcaggcatgaagacg
gtaatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgattgcaggcggt
atggaaagcatgagccaagcgccgtatttactcgataaagcccgcggcggcatgcgcatg
ggtcatggcaaagtgttagatcacatgtttttagatggtcttgaagatgcctacacgggt
ggtgctatgggaacgtttgcccagaaaacggccgatgaatttggtatcacccgcgagcag
atggacgcttttgccctaagctcgctcgaaaaagccaatgccgcgattaactcgggtgcc
tttaaagccgaaatcacgcccgttactgtcagtgatcgtcgcggtgatgtgactatcgat
accgacgagcaacccggtaatgcccgccctgaaaaaattcctacactgcgcccagccttt
accaaagatggcactatcacagcggcaaactctagctcgatttccgatggcgcagcggca
ttaatgctgacctcgcgcggcgaagctgaccgtttaggcttaactgtattagcgactatt
aaaggccacacgactcacgcccaagagccttcattgttcaccactgcaccggttggcgcc
atggcgaaattgctggctaatgtcggttggtcaacggatgaggtggatttattcgaaatc
aacgaagcctttgccatggtgactatgcttgctgtgtctgaacttggtttagatatcgct
aaggttaacgttaatggcggcgcctgtgccctaggtcatccgattggctgctcgggttca
cgtttgctggtgaccttaattcatgctttaaaagcccgtggccttaaacgcggtgttgcc
tcgctgtgtatcggcggcggtgaagcgacggcgatggccatcgaggtctaa

DBGET integrated database retrieval system