KEGG   Shewanella baltica OS678: Sbal678_2886Help
Entry
Sbal678_2886      CDS       T01725                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00860  Porphyrin and chlorophyll metabolism
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
Module
sbt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sbt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sbal678_2886
Enzymes [BR:sbt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Sbal678_2886
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Sbal678_2886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 CysG_dimeriser Sirohm_synth_M TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADT95035
Position
complement(3378598..3379509)
Genome map
AA seq 303 aa AA seqDB search
MQYFPLFVDTVNLNVLLVGAGDVASRKLALLTRTEASIHVIAPEVNPEVQRYADTGRILL
SQREVVHADIQNYDLVYLATANDSLNAELATLATARGIWVNAVDNPAFCRFITPSIVDRG
RLVVAISTAGAAPIFARTIRSRLESSLPQSLKSLFDFVADRRVEVQDKLDSTSKRRLFWE
RFFDTNGDRFDSRTAEHYHNAFNNLVSRGEILLLDDATSVDLLPLAAMPLLQRLDWIYSQ
GDLSDELAELVRRDANRGELPALSELSQQYEQGTRMLLVADTQKISLLKAHFPMAKHLRP
GAI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatttccccttgtttgtcgatacggttaacttaaatgttttgctggtgggggcg
ggtgatgtggcgagccgtaagctggcgctgctaacacgtaccgaagccagtatccatgtg
atagcccctgaggtgaatcctgaagtgcagcgttatgccgatacgggcagaattctgcta
tcccagcgtgaagtggtccacgccgatattcaaaattatgatctggtgtatttagccacg
gcaaacgatagtcttaatgccgagttggcgactctagccaccgcgcgcggtatttgggtt
aatgccgttgataatccggcattttgccgttttatcaccccttcgattgtcgatagaggc
cgtttagtcgtggcgatcagcactgcgggcgcggcaccgatatttgcacgcacgattcgc
tcgcgcttagaatccagcctaccgcaatcactcaagtctttattcgactttgtcgccgat
agacgcgtcgaagtgcaagacaagctcgattcaacctcgaaacgtcgcttattttgggaa
cgttttttcgataccaatggcgaccgtttcgatagtcgtaccgccgagcattaccataat
gcgtttaataatttagttagccgcggcgaaatccttttgctggatgatgcaacctctgtg
gacttactgccgctcgctgccatgccgttactgcagcgcctcgattggatctatagccaa
ggcgatttgagcgatgaattggccgaattagttcgccgagatgctaatcgtggtgagtta
cccgcactcagtgaattgagccagcagtacgagcagggcactcgcatgttgctagtggcc
gatacgcaaaaaatcagtctgttgaaggcgcatttccccatggctaagcatctgcgaccc
ggcgcgatttaa

DBGET integrated database retrieval system