KEGG   Shewanella baltica OS678: Sbal678_3679Help
Entry
Sbal678_3679      CDS       T01725                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00010  Glycolysis / Gluconeogenesis
sbt00030  Pentose phosphate pathway
sbt00051  Fructose and mannose metabolism
sbt00680  Methane metabolism
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
sbt01130  Biosynthesis of antibiotics
sbt01200  Carbon metabolism
sbt01230  Biosynthesis of amino acids
Module
sbt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal678_3679
   00030 Pentose phosphate pathway
    Sbal678_3679
   00051 Fructose and mannose metabolism
    Sbal678_3679
  09102 Energy metabolism
   00680 Methane metabolism
    Sbal678_3679
Enzymes [BR:sbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Sbal678_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ADT95815
Position
complement(4261277..4262344)
Genome map
AA seq 355 aa AA seqDB search
MALISLRQLLDHAAEHGYGVPAFNVNNLEQMRAIMQAAEATDSPVIVQASAGARKYARPQ
FLKYLMAAALEQYPDIPVCIHQDHGTDPDICQRSIQLGMSSVMMDGSLMADGKTPASYDY
NVDVTRRTVAFAHACGVSVEGEIGCLGSLETGQAGEEDGIGAVGTLSMDQMLTTPDEAAR
FVADTHVDALAIAIGTSHGAYKFSRKPTGDVLRIDRIKEIHARIPNTHLVMHGSSSVPQE
WLQIINQYGGQIPETYGVPLEEIVEGIKHGVRKVNIDTDLRLASTGAVRKFLAEHPSEFD
PRKFLKASMEAMADICTVRYEAFGCAGQASKIKPLSLQAMYKAYQSGALDPKINM
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaatttccctacgacaactactcgaccacgcggcagaacatggatacggtgtg
cctgcgttcaacgttaacaacttagagcagatgcgtgccatcatgcaggccgctgaagca
acagacagccctgttattgtgcaagcttctgctggtgcgcgtaaatatgctcgcccacag
ttcttaaaatatttgatggctgcagcccttgagcagtatccagatattcctgtgtgtatc
caccaagaccacggtaccgatcctgatatctgtcagcgttctatccaattaggcatgtca
tcagtgatgatggatggctctttgatggctgacggcaaaacccctgcatcgtatgactac
aacgtcgatgtcactcgtcgcacagtggcatttgcccatgcgtgtggtgtgtcagttgaa
ggcgaaatcggctgtttaggcagtttagaaactggccaagcaggcgaagaagacggtatt
ggtgcagtgggtacattaagcatggatcaaatgctgaccactcctgatgaagcggcgcgt
ttcgttgctgatacccatgttgatgcacttgccatcgctatcggtactagccacggtgct
tacaagttcagccgtaaacctacgggtgatgtactgcgaatcgaccgcatcaaagaaatc
catgcgcgtattcctaatactcacttagtgatgcacggttcatcttcagtgccacaagaa
tggttacagatcatcaaccaatatggtggtcagatcccagaaacctacggcgtgccatta
gaagaaatcgttgaaggtatcaagcacggtgtgcgtaaggtgaatatcgatactgactta
cgtttagcatcaacgggtgcggtacgtaagttcttagcggaacacccaagtgaatttgac
ccacgtaaattcttgaaagcgtcaatggaagccatggcagacatctgtactgttcgctac
gaagctttcggttgtgctggtcaagcatctaagattaaaccattgtctttacaagcaatg
tataaagcgtatcagtctggcgcgttagatcctaagatcaacatgtaa

DBGET integrated database retrieval system