KEGG   Sphaerochaeta globosa: SpiBuddy_0232Help
Entry
SpiBuddy_0232     CDS       T01439                                 

Definition
(GenBank) Glycoside hydrolase, family 20, catalytic core
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00511  Other glycan degradation
sbu00520  Amino sugar and nucleotide sugar metabolism
sbu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SpiBuddy_0232
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SpiBuddy_0232
Enzymes [BR:sbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SpiBuddy_0232
Chaperones and folding catalysts [BR:sbu03110]
 Intramolecular chaperones
  Others
   SpiBuddy_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADY12072
UniProt: F0RXM2
Position
complement(257781..259262)
Genome map
AA seq 493 aa AA seqDB search
MTEKLPLIPYPSGAIAMLNGTYMHPSSLVVALDPVFDTEHVLHYVKEYLGVEAEKGERSP
NLTIAKAIDLKDEEAYRLELQPCGCRIEAQDLKGIFYAVQTLRQLFLAYPHAIPCCRIQD
APALHWRAFMLDVARSFCPVEEIRRIIDILASCKINVLHLHVSDDQGWRIALDCFPNLGE
EESGRYSKQEIRDLVAYAQDRQIMVVPEIDMPGHFTAALAAYPKLSCTGGPFTVPKGEGI
FPDILCVGKDEALAFVKTVITEIASLFPAPYIHLGGDEIPLDRWVACPDCQKRKKALLLS
DEKALLRWFCNEMTMHAASLGKQVILYNDYLDQDYNKNIITQVWNPLLDASLSEHPAIMS
DYFHTYLDMDHTLLPLQVVYRYGKQLQTEKDANLFGAELMLWTEYICTRAERDLHLFPRL
IAGAESFWTHQGQHDYRRFVDIFGRYGEQFLPPETHITPRKQWNSCFIISVLQRYKRRRR
VKRNSKKAGIALS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaagctccctctcattccctatccttcaggtgccatagcaatgctcaatggt
acatacatgcacccctcgtccttggttgtagcgcttgaccctgtgtttgacaccgagcac
gtactgcactacgtcaaggagtaccttggtgttgaggcagaaaagggtgagcggtcaccc
aacctgaccattgcaaaggcaatagacctgaaagatgaagaagcatatcgcttggaactg
caaccttgcggatgcaggattgaagcgcaggatttgaaagggatattctacgcagtgcag
acactgcgtcagctctttcttgcctatccccacgccattccctgttgccgtatccaggat
gctcccgccctgcattggcgcgctttcatgctggatgtagccaggtccttctgtccggtt
gaggagattcggaggatcatcgacatcctcgcttcctgtaaaataaatgtactgcacctg
catgtcagcgatgaccaagggtggagaatcgcactggattgctttcctaacctaggagaa
gaggaatcgggcaggtattcaaagcaagagatcagagacctggtagcgtatgcacaagac
aggcagattatggtcgtccccgagatcgacatgcccggacacttcaccgccgctcttgct
gcctatcccaagctcagctgcacgggaggaccgttcaccgttcccaagggagaaggcatt
ttcccagacattctgtgtgtgggaaaggacgaagcccttgctttcgtgaaaactgtcatt
actgagatagcctccctcttccctgccccctacatccatttggggggcgatgagattccc
ctggaccgttgggtcgcctgccctgactgccagaagagaaaaaaagcactgctcttatcc
gatgagaaagccttgctgcgatggttttgcaacgaaatgactatgcatgcggcaagcctg
ggaaaacaggtaatcctctacaacgattacctggaccaagattataacaagaatatcatc
acgcaggtgtggaacccgctgctggatgcctccttatcagagcaccctgcgattatgagt
gactatttccatacgtatctggatatggaccatacattgcttcccctacaggtggtctat
cgctatggcaagcaattgcaaactgaaaaggatgcaaatctgttcggtgcagagctcatg
ctgtggaccgagtacatctgtactcgagcagagagggacttgcatctgttcccacgcctg
attgcaggtgccgagtccttttggacacaccaaggccagcatgactatcgtcggtttgtg
gatatatttggccggtatggtgagcaatttctcccgcctgagacacatatcacacccaga
aagcagtggaacagttgcttcatcatctctgtactccaacggtacaagcgtaggcgaaga
gtgaagcgaaacagcaagaaagctggtattgctctctcctaa

DBGET integrated database retrieval system