KEGG   Sphaerochaeta globosa: SpiBuddy_0532Help
Entry
SpiBuddy_0532     CDS       T01439                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SpiBuddy_0532
Enzymes [BR:sbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SpiBuddy_0532
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SpiBuddy_0532
    1.1.1.-  
     SpiBuddy_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADY12365
UniProt: F0RUK3
Position
complement(570761..571795)
Genome map
AA seq 344 aa AA seqDB search
MQALVLTDYKNLQMQEVPKPTLLSPTQVLVRIKAASICGSDVHGYDGSTGRRRPPITMGH
EGSGIIEEAGSLVTNFKVGDRVTFDSTIYCGTCSFCKQGLFNLCDNRRVLGVSCADYHQD
GIFAEYALIEERVLFHLPEGLSFEEAAMAEPAGVAAHAISLASPKLGEDVAVVGAGLIGL
LVIKLLRTMTSGTIIAIEMDEQRREKALQIGSDVVLDPRDPELIAKIRALTKGEMLPLVY
EAVGASSPINTAISLVRKGGTVVLVGNITPTIELPLQSVVTRQIRLQGSCAINGEYPAVL
KMMADKKLDVTDLISKVAPLNEGKIWFDKLYNREDNLLKVVLVP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattggtgttgaccgactataagaaccttcagatgcaggaagtaccaaaacct
accttgctatcccctacccaggtgctggtacgcatcaaggccgcctcgatttgcggcagc
gatgtccacggttatgacggatcgaccggaaggcgcagacctcccataactatggggcac
gaaggaagcggtatcatcgaagaggcggggtcgctggtaaccaatttcaaggtcggtgat
cgggtaaccttcgactcgaccatctactgcgggacctgttcattctgcaagcaaggcttg
ttcaacctgtgcgacaatcgcagggtgctgggagtaagttgtgccgattaccatcaggat
ggcatttttgcagagtatgctctcattgaggaacgggttcttttccacctacccgaagga
ctctcctttgaggaagctgccatggccgagcctgcaggggttgccgctcatgccatcagc
ctggcaagtcccaagcttggagaggatgtggcggtggtgggcgccggcttgatcggactc
ttggtaatcaagcttctcaggaccatgacaagcggaaccatcatcgccattgagatggat
gaacaacgaagagagaaagcgcttcagataggttctgacgttgtcctcgatccccgcgac
cctgaattgattgcaaaaattagagcccttaccaagggtgaaatgctgccgctcgtctat
gaggcggtcggggcaagcagcccgatcaatacggctatttcgctggtacgcaaaggcggg
acggtagttttggtaggaaatatcaccccaaccatagagctgccgctgcaaagtgtggtc
accaggcagatcaggttgcagggctcttgtgccatcaacggggagtatccggcagttctg
aaaatgatggctgacaaaaaactggatgttaccgacctgatcagcaaagtcgctcccctg
aatgagggaaaaatctggtttgacaaactctataaccgagaggataacctacttaaggtt
gttctggttccctga

DBGET integrated database retrieval system