KEGG   Sphaerochaeta globosa: SpiBuddy_0581Help
Entry
SpiBuddy_0581     CDS       T01439                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00010  Glycolysis / Gluconeogenesis
sbu00030  Pentose phosphate pathway
sbu00051  Fructose and mannose metabolism
sbu00052  Galactose metabolism
sbu00680  Methane metabolism
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01120  Microbial metabolism in diverse environments
sbu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_0581
   00030 Pentose phosphate pathway
    SpiBuddy_0581
   00051 Fructose and mannose metabolism
    SpiBuddy_0581
   00052 Galactose metabolism
    SpiBuddy_0581
  Energy metabolism
   00680 Methane metabolism
    SpiBuddy_0581
Enzymes [BR:sbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SpiBuddy_0581
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SpiBuddy_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK CHASE2
Motif
Other DBs
NCBI-ProteinID: ADY12414
UniProt: F0RXZ0
Position
620178..621353
Genome map
AA seq 391 aa AA seqDB search
MHENLLIIHGGAPTAVMNASLYGVIKQAKDSGVCRHVYAARGGTQAVLTEDFIDLLTIDE
QTIAQLPHTPASWIGTSRFHVSDDDYAKMVEVLLECNITGVFFNGGNGSMDACGKLARAI
KAHPIARSKGIRVVGIPKTIDNDLAITDHAPGFGSAARYLASSVQELSQDVASLPIHVCI
IESMGRNAGWLTAAAALAKTEERVGPHLIYVPEVAFDEERFLDEARSLYEKHGGVVVVAS
EGLRTTEGSPIVKPIFQVGRSVYYGDVSAHLCNLVIQKLGIKARSEKPGILGRCSIAFQS
EVDRDEAILAGREAVKALLEGKSEVMVGFERINSEPYLCKTILIPLEQVMLHERTLPIQY
VRDAGKIDEAYLAWCKPLIGSPLASFPKREV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagaatttgttgataattcatggtggggcaccgacagcggtgatgaatgcctcc
ttgtatggggtaatcaagcaggcgaaggattcgggagtatgccggcatgtttatgctgca
agaggggggacgcaagccgtccttacagaggatttcatcgatctcttgaccatcgatgaa
cagactattgcacagttgccccatacccctgcctcatggatcggtacaagccgctttcac
gtcagtgacgatgactatgccaagatggtggaagtcttgctcgaatgcaatatcaccgga
gtattcttcaatggaggcaatggttcgatggacgcctgcggcaagctggctagagccatc
aaagcccatccgatagcgagaagtaaaggtattcgggtggtgggtatccccaagaccatc
gacaacgatttggccatcaccgatcatgctcctggtttcggcagtgctgcccgttacttg
gcctcctcggttcaggaactgagccaagatgtggcatcgcttcccattcatgtctgtatt
atcgagagtatgggtcggaatgcaggctggcttaccgccgccgcagcattggcaaagaca
gaagagcgtgtaggtccccatctcatctacgtacctgaagtagcctttgatgaagagcgt
ttcctcgatgaggcgaggagcctgtatgagaaacatggaggcgtggtagtggtagcctct
gaggggttacggaccactgaaggctctcctattgtgaagccaatctttcaagtagggcga
tcggtctactatggagatgtatcggcacacctgtgcaatctggtgatccagaaattggga
atcaaggcacgtagtgagaaaccaggcatcctcgggcgctgttccatcgccttccaatcg
gaagtcgaccgcgatgaggcaatcctggccggtagggaagccgtcaaagccttgttggaa
ggtaagagtgaggtaatggtaggctttgagcgcatcaacagtgagccctatctttgcaag
actatcctcatcccccttgagcaagtcatgttgcacgaacgtaccttgcctatacagtat
gtgagggatgccggaaaaattgacgaagcatatctagcttggtgcaaaccattaatcggc
tctccacttgcttcttttcctaagcgtgaggtgtag

DBGET integrated database retrieval system