KEGG   Sphaerochaeta globosa: SpiBuddy_1169Help
Entry
SpiBuddy_1169     CDS       T01439                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00010  Glycolysis / Gluconeogenesis
sbu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_1169
Enzymes [BR:sbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SpiBuddy_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase DUF2608 Mur_ligase_M ProRS-C_2
Motif
Other DBs
NCBI-ProteinID: ADY12994
UniProt: F0RVK2
Position
1254139..1254792
Genome map
AA seq 217 aa AA seqDB search
MKLFAMLSSLSMNTNFALIMVDMGGVLALHTDTGMEKLLLRDFGLQEYDSFSELDPTLPD
LLQEHSKNCITEEQMWERFTQKTGIVVPPYKGSLWAKYFQPELDQAMLQLLSELKQNGYR
VVCATNTEAAHYEHHKTMQHYAVFDTVYASCEIGKAKPEPEFFTHILQCENVQGEQVIFI
DDNAKNCEVASSLGIRAYHYEDISDLRWALLDMEMIQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtttgctatgctatcatcgctctctatgaataccaattttgcactgattatg
gttgatatgggtggggtgcttgcacttcacaccgacaccggtatggaaaaactcctgctt
agggattttggcctacaagagtatgacagtttttcagagctcgatcctacgcttcccgac
ttgctgcaggaacatagcaagaattgcatcactgaagaacagatgtgggaacgattcacc
cagaaaaccggtattgttgttcccccttacaaaggttcgctatgggctaagtacttccaa
ccggaacttgatcaggcaatgcttcaacttctttctgagctgaaacagaatgggtatcgg
gtggtctgtgctaccaatacggaggcggctcattatgagcaccataagactatgcagcac
tatgcagttttcgataccgtctatgcttcatgcgagatcggaaaggcaaagcccgaacct
gagttctttacccatatactgcaatgtgagaatgtccagggcgagcaggtgattttcata
gatgataatgcaaagaactgcgaagtggcctccagccttggtatccgggcatatcattat
gaagatatttcagatttacgatgggctcttttagatatggaaatgattcaatag

DBGET integrated database retrieval system