KEGG   Sphaerochaeta globosa: SpiBuddy_1630Help
Entry
SpiBuddy_1630     CDS       T01439                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
sbu  Sphaerochaeta globosa
Brite
KEGG Orthology (KO) [BR:sbu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SpiBuddy_1630
Enzymes [BR:sbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     SpiBuddy_1630
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     SpiBuddy_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ADY13455
UniProt: F0RW98
Position
complement(1775354..1776322)
Genome map
AA seq 322 aa AA seqDB search
MKRFGITLGDPCGIGPEITLKALYANELYQRHALLFGSHAILEYYNQELGYGFVFNALTT
IDSWKEDAINLYDPIPSVTLADIQIGKVTALGGELAFQSVRTSIEFALRGDISSVVTAPL
NKEALHLAGHKFAGHTEIFGFYSHGPSYAMLLWSEKLKAIHVSTHISLRQACDACTKERV
LDVIHLADATLKKAGYACPRIAVAGLNPHAGENGLFGTEELEHIIPAVEAARGEGIAVEG
PIPPDTVFLKAMKGGYDIVVAMYHDQGHIPLKMLAFDSGVNITVGLDVVRTSVDHGTAFD
IAGKLVASEKSLLEAISIGMKL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttttggtatcacactgggagatccctgcgggatcggtccggaaatcaccttg
aaggcactgtatgccaacgagctctatcaaaggcatgctctcttgtttggcagccatgca
attttggagtattacaatcaagagcttggctatgggtttgtattcaatgcccttacaacc
atcgatagttggaaagaggatgccatcaacctctatgatccgattccgtcggtaacattg
gcggacatccagataggaaaagtgactgctttgggtggggagctggcattccaaagcgta
cgtacatcaatcgaatttgccctacgaggggatatttcctcagtggtgaccgctcccttg
aacaaggaagccttgcatttggccggacacaagttcgccggtcataccgaaattttcggc
ttctattcccatggtccttcgtatgccatgctgctgtggagtgaaaagctgaaagccatt
catgtttccactcatatctcccttcgacaagcatgtgatgcctgcacaaaggaacgagtt
ttggatgttatccaccttgccgatgcaaccctcaagaaagcagggtatgcctgtccgagg
attgcagttgccggcttgaatcctcatgccggggagaacgggctgttcggtaccgaagag
ctagagcacatcattccggctgttgaagcagcccgcggggaaggtattgccgttgaaggt
cccattcctcctgataccgtgtttctgaaggcaatgaagggaggctacgacattgttgtg
gcgatgtatcacgatcaaggccatattcccttgaaaatgctcgcattcgacagcggagtg
aatattaccgtaggtttggatgttgtcaggacatcggttgaccatggtacagccttcgat
atagcaggtaagcttgtcgccagtgaaaagagtctgcttgaggctatatccataggtatg
aaactctag

DBGET integrated database retrieval system