KEGG   Sphaerochaeta globosa: SpiBuddy_2477Help
Entry
SpiBuddy_2477     CDS       T01439                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00010  Glycolysis / Gluconeogenesis
sbu00020  Citrate cycle (TCA cycle)
sbu00620  Pyruvate metabolism
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01120  Microbial metabolism in diverse environments
sbu01130  Biosynthesis of antibiotics
sbu01200  Carbon metabolism
Module
sbu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_2477
   00020 Citrate cycle (TCA cycle)
    SpiBuddy_2477
   00620 Pyruvate metabolism
    SpiBuddy_2477
Enzymes [BR:sbu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SpiBuddy_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 RP-C_C
Motif
Other DBs
NCBI-ProteinID: ADY14290
UniProt: F0RRN1
Position
complement(2689177..2690487)
Genome map
AA seq 436 aa AA seqDB search
MAIKQILIPDIGDFEDVPIIDVYIKVGDIIAVEGSVVALESEKAVIDIPSPFAGTVTKVL
IKEGDTVSKGSLVAEIEVASEEVEEAKQSSAKEPEKQQPAAPKEEIKPEVVAEIEQPTEV
AEEKEPASELINEQAPGAVFHATPSLRKYARELGVDLALVKGSGPNGRILHEDVQALVKK
ALSGSKESTASFGKIELEDFSKYGKTERKRLSRIQKISGPHLQKSWQIIPHVTQFDEADV
TDLEVLRKAIKEEMKRSDEPVNISILPFIIKAVVAALKKFPEMNASFDEDSGELILKHYY
HIGVAVDTPEGLIVPVLKDADTKSVTEIAREITSISQRARDRKLKPEDLSGGSFSISSLG
GIGGTAFTPLINPPQVAILGVSRLTKKPVWNGKEFAPRDVLPFSVAYDHRVIDGAAAVRF
TTYLASLLGDLRRVLL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaagcaaatactcatcccggatatcggggatttcgaagatgtgccgatcatt
gatgtgtacatcaaagtcggtgatatcattgcagttgaaggctccgtggtagctcttgaa
agtgagaaggctgtcatcgatattccttccccctttgcagggaccgtcacaaaggttctg
atcaaggagggcgatactgtctccaagggctctctggtggcggagattgaggttgcatca
gaagaagttgaagaagcaaagcaaagctctgcaaaagagcccgagaaacaacaacctgct
gcacctaaggaagaaataaagccggaagtggttgctgaaattgagcagccgacagaagtg
gccgaagagaaagaacctgccagtgagcttatcaatgaacaggcaccgggtgctgtcttt
catgctaccccttcactacgcaagtatgcacgggagctcggagtcgatcttgctctggtg
aagggtagcgggcccaacggaaggatcttgcatgaagatgtgcaggctttggtcaagaag
gctctcagtggtagcaaagagtctactgcttccttcggcaaaatcgagctggaggacttt
tcaaagtacgggaagaccgaacgaaagagactttcccgtattcagaaaatctccggaccg
catctgcagaagagttggcagatcattcctcatgtcacccaatttgatgaggctgatgtc
accgatcttgaggttttgcgaaaggcgatcaaggaagagatgaagcgaagtgacgagcct
gtgaatatcagcatccttcccttcattatcaaggctgttgtcgcagcattgaagaagttc
cctgagatgaacgcttcctttgatgaggacagcggtgagttgattctcaagcactactac
catatcggggttgctgtggacacccccgagggcctgatcgtaccggttctcaaggatgcc
gatacgaagagtgtgacagagattgcaagagagattacatccataagccagcgtgcccga
gacagaaaactgaagccggaggaccttagcggaggatcgttcagcatttcaagcctcgga
ggaatcggtggtacggcattcacgcccttgatcaacccaccgcaggttgccatccttggt
gtctcacggcttaccaagaagccggtatggaatggcaaggaatttgctccccgtgacgtt
ctgcctttctctgtagcctacgaccatagagtcatcgatggtgctgcagcagttcgcttt
accacgtatctcgcctccctcttgggcgatttgcgacgtgtactactctaa

DBGET integrated database retrieval system