KEGG   Sphaerochaeta globosa: SpiBuddy_2565
Entry
SpiBuddy_2565     CDS       T01439                                 

Definition
(GenBank) Xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00230  Purine metabolism
sbu01100  Metabolic pathways
sbu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SpiBuddy_2565
Enzymes [BR:sbu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SpiBuddy_2565
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ADY14376
UniProt: F0RT71
Position
2785997..2788285
AA seq 762 aa
MDIIGTSLKRVDAFDKVTGKAKYTDDLVSDHALIAKVLHSTIANGWVKEFDLSEAWKVNG
VVDIVTCFDVPNIQFPTAGHPWSTDPKHQDIADRKLLNARVRCYADDIAAVIAEDEIAAE
EAVRKIKVTYEEFTPILTVEDAMKEGAITLHDERPNNIVVKSTYEIGKFEEAIKEEGLIK
VVGDYETPVVSHCHIESANSFAYMESDKIVVVSSTQIPHIVRRICSQALGLGFGKIRIIK
PYIGGGFGNKQDALTEPLNAYLTTRVGGRPVKLAYTREETFACTRTRHAMQFHIESYIRK
DGSFAARSIKAYSNQGAYASHAHALVANAVNGFRMMYPVGAIKSEAYTVYTNLPTAGAMR
AYGIPQIGFALEAHVDDIARQTGLDPLVMRKLNMMKLGYVDPLTTITCHSTGLEECIDRG
EKYLDYSKKRVAYAHQTGPIRKGVGMAIFCYKTGVYPISLETSACRMILNQDGSLQMQIG
ATEIGQGADTVFAMMAAQTIGVTMDKVHVISKQDTDVTPYDTGAYASRQTYVSGMAVKKT
AESFRKKILEFAGFMLKKDSWDLDIKDNNIVHVNKNEKLLSVADVAIESCYSLTNSTHIA
AEESHHCTDNTYSFGVCFTEVEVDIPMCQVKILDIINVHDSGKIINGQTARGQVHGGMSM
GLGYGLYEHLKFDPKTGQMLNDNLLDYKLMTAIDTPELHADFVQTDDPTGPYGNKSLGEP
PTIPVAPAIRNAVLNATGVAINAIPLHPQRMFDAFIEAALIK
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggatataatcggaacttccctgaaacgagtcgatgcgttcgacaaagtgacaggtaaa
gcgaaatacacggacgatttggtttcagatcatgccctcattgcaaaagtactgcatagc
accattgcaaacggctgggtcaaggagtttgatctcagcgaagcgtggaaggtcaacggt
gttgtggatattgttacctgcttcgatgtacccaacatccagttccccaccgcaggccac
ccttggtcgactgatccgaagcatcaggacattgcagaccgaaagttgctcaatgcaagg
gttcgctgttatgccgatgacatcgctgccgtcattgctgaggatgaaattgctgccgaa
gaggcagtgagaaaaatcaaggtcacgtatgaggaattcacccccattcttaccgtcgaa
gacgctatgaaggaaggggcgataaccctccatgacgagcggccgaacaatattgttgta
aagtcaacctacgaaattggcaagttcgaggaagcaatcaaggaagaaggactgatcaag
gtagtcggagactatgaaactccggtagtaagccactgccatattgagagtgcaaactcc
tttgcctacatggagagtgacaagattgtcgtggtcagctccacccaaatcccccacatt
gtcaggcgtatttgttcacaggcccttggccttggcttcggcaaaatcaggattatcaag
ccgtacatcggcggtgggtttggaaacaagcaggatgctttgaccgaaccgttgaatgcg
tacctcaccacccgagtcgggggaaggcctgttaagcttgcctacacccgcgaggaaacc
ttcgcctgtacccgtacccgtcatgccatgcaattccatattgaaagctatatccgcaag
gacggcagtttcgccgcccgctcaatcaaggcttactccaaccagggtgcctatgcatcc
catgcacatgccctcgtagccaatgcagtaaacggttttaggatgatgtatccggtagga
gccattaaaagtgaagcctacacagtctacaccaacctgcccactgcaggagccatgcgt
gcatacggtattccccagatcgggtttgccttggaagcccacgtcgacgacattgccagg
cagaccggtctcgatccgcttgtaatgcgtaagctgaacatgatgaagcttgggtatgtc
gacccgcttaccaccatcacctgtcactccaccggtttggaggagtgcatcgaccgaggt
gaaaagtacctcgattattccaagaaacgggttgcctatgcccaccagacaggtccgatc
aggaagggtgtgggtatggcaattttctgttacaagacaggtgtctaccccatcagcttg
gagacttccgcctgccgcatgattctcaaccaggacggttcgctgcagatgcagatcgga
gctaccgaaattggacagggggccgacaccgtttttgccatgatggcagcccagaccatc
ggagtgacgatggataaggtgcatgtgatcagcaagcaggacaccgatgtcaccccgtat
gacaccggagcttatgcctccaggcaaacctacgtatcgggtatggcagtcaaaaagacc
gctgaatccttcaggaaaaaaattcttgaattcgccggtttcatgctgaagaaggatagc
tgggatttggatatcaaggacaacaacatcgtgcatgtcaataagaacgagaaattgctc
agcgtcgccgatgtcgccattgagtcctgctacagcttgaccaattccacccacattgct
gccgaggaatcacaccactgtacggacaacacctactccttcggggtctgctttaccgaa
gtcgaggtggacattccgatgtgccaggtcaagatcctggacatcatcaacgtccacgat
tccggcaaaatcatcaatggacagaccgcacgcggacaggtccatggcggtatgagcatg
ggcttggggtacgggctgtatgaacacctgaagttcgacccgaaaaccggtcagatgctc
aacgacaaccttttggactataagctgatgacagccatcgatacgcccgaactccatgcg
gactttgtacagaccgatgaccccaccgggccttatgggaacaagtcattgggagaaccc
ccgacgattcctgtcgcgcctgcaattcgtaatgcggtgcttaatgcaaccggagttgcc
atcaatgccattcccctgcacccacagcggatgttcgacgcattcatcgaagcggccctg
attaaataa

DBGET integrated database retrieval system