KEGG   Sphaerochaeta globosa: SpiBuddy_2567
Entry
SpiBuddy_2567     CDS       T01439                                 

Definition
(GenBank) Carbon-monoxide dehydrogenase (acceptor)
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00230  Purine metabolism
sbu01100  Metabolic pathways
sbu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SpiBuddy_2567
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ADY14378
UniProt: F0RT73
Position
2789177..2789665
AA seq 162 aa
MANKDVHCIVNGKERVFSVDVRSSLSDMLRGNAGLDSIKHGCDVGECGACTVLIDGKPFN
TCIYMAIWAEGKTILTLEGLSDTKGTISDIQQAFIDEGAVQCGFCTPGFIMASIPIIEKD
EPSTREEIRRQISGNLCRCTGYEHIVDAIEKTQKKRIEQKKG
NT seq 489 nt   +upstreamnt  +downstreamnt
atggctaacaaagacgtacactgtatcgtgaacggaaaagagagagtattcagtgtggat
gttcgatcatccctttcagatatgctcaggggtaatgccggcttggacagcatcaagcat
ggctgtgacgtaggcgaatgtggtgcgtgcaccgtactcatcgacggaaaaccgttcaac
acctgtatttatatggctatctgggctgagggaaaaaccattctcacccttgaagggctc
agtgacaccaagggtaccatcagtgacatccagcaggcgttcatcgatgagggagctgtc
cagtgcggtttctgcaccccgggtttcatcatggcctccattcccatcattgaaaaggat
gagccttccacccgagaggagatccgaaggcaaatttcaggcaacctctgccgatgcacc
ggctatgaacacattgtcgatgcaattgaaaagacgcagaagaagcggatcgagcagaaa
aagggctga

DBGET integrated database retrieval system