KEGG   Salmonella bongori serovar 48 z41 --: N643_01790Help
Entry
N643_01790        CDS       T03249                                 

Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00900  Terpenoid backbone biosynthesis
sbv01100  Metabolic pathways
sbv01110  Biosynthesis of secondary metabolites
sbv01130  Biosynthesis of antibiotics
Module
sbv_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N643_01790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sbv01006]
    N643_01790
Enzymes [BR:sbv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     N643_01790
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     N643_01790
Prenyltransferases [BR:sbv01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   N643_01790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: AID24170
Position
complement(409718..410617)
Genome map
AA seq 299 aa AA seqDB search
MDFMQQLQACVTQANLALSRFITPLPFQNTPVVEAMQYGALLGGKRLRPFLVYATGKMFG
VSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHIKFGEANAILAGDALQTL
AFAIISDAPMPEVADRDRIAMIAELANASGIAGMCGGQALDLAAEGQQISLDALERIHRH
KTGALIRAAVRLGALSAGDKGRNALPILDRYAESIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARNKARDLIEDARQSLNQLAAQSLDTSALEALANYIIQRDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggattttatgcagcagcttcaggcttgcgttacacaagcgaatctggcgctaagccgt
tttatcacgccactgccctttcagaacactcccgtggtcgaagccatgcagtacggcgca
ttattaggtggtaaacgcctgcgtccgtttctggtttacgcaactggaaagatgtttggc
gttagcacggcaacgctggatgcgccagccgctgcggttgaatgtatccatgcctattcg
ctgatccatgacgacctgccagcgatggatgatgacgatttgcgccgcggtctgccgact
tgccatattaaatttggcgaagccaatgcgatcctggcgggagacgcgttgcaaacgctg
gcgtttgccattatcagcgatgcgccgatgccggaagtggccgatcgcgatcgtatcgcg
atgatcgccgaactggcgaatgccagcggtatcgccggaatgtgcggcggccaggcgtta
gatctggcggcagaaggccagcaaatatccctggacgcgctggagcgaattcatcgccat
aagaccggcgcgctcattcgtgccgctgtgcgtcttggcgcgttaagtgctggcgataag
gggcggaacgctctgccgatacttgaccgctacgcagaaagtattggccttgccttccag
gttcaggatgacattctggatgtggtgggcgatactgcaacgttaggtaaacgtcagggc
gcagaccagcagcttggcaaaagtacctaccctgcacttctgggtcttgagcaagcccgg
aataaagcccgggacctgatagaggacgcccgtcagtcgttaaatcaactggccgcacaa
tcactggacacctcggcactggaagcgctagcgaactacataatccagcgtgataaataa

DBGET integrated database retrieval system