KEGG   Salmonella bongori serovar 48 z41 --: N643_04545Help
Entry
N643_04545        CDS       T03249                                 

Definition
(GenBank) glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00010  Glycolysis / Gluconeogenesis
sbv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N643_04545
Enzymes [BR:sbv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     N643_04545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AID24564
Position
994414..995649
Genome map
AA seq 411 aa AA seqDB search
MKKTLLAVAGAVLLSSAVQAQTTPEGYQLQQVLVMSRHNLRAPLANNGSILEQSTPNAWP
EWDVPGGQLTTKGGILEVYMGHYTREWLVAQGLIPSGECPAPGTVYAYANSLQRTVATAQ
FFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSATFRQQAVQAMEKARRQMHLDESYK
LLEQITRYQDSPSCKEKHQCSLIDAKDTFSADYQKEPGVQGPLKVGNSLVDAFTLQYYEG
FPLDQVAWGEIKTDRQWKVLSKLKNGYQDSLFTSPAVARNVAAPLVRYIDKALVVDRASA
SKMTVLVGHDSNIASLLTALDFKPYQLHDQYERTPIGGQIVFQRWHDRKANRELMKIEYV
YQSARQLRNAEVLTLKSPAQRVTLELKGCPVDANGFCPLDKFDAVMEAAAK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgttactcgctgtggctggggctgttttgttgtcatccgccgttcaggcg
cagacaacgccggagggctatcaattacaacaggtgctggtgatgagccgccacaacctg
cgggcgccactggcaaataatggcagtatactggagcagtcgacgccgaatgcctggccg
gagtgggacgttcccggcgggcaactgacgacgaaaggcggcatactggaagtctatatg
gggcactacacgcgtgaatggctggtggcgcagggactaataccgtcgggagaatgtccg
gcgcccggtaccgtatatgcctatgcgaatagcttgcagcgcactgtggctaccgcgcaa
ttttttattaccggcgcttttcccggctgcgatattcctgttcatcatcaggaaaaaatg
ggtaccatggaccctaccttcaatccggtgatcaccgatgattccgccacgttcaggcaa
caggccgtacaggcgatggaaaaagcacgtcgtcagatgcaccttgatgagagttataaa
ctgcttgagcaaataacacgctatcaggattcgccatcctgcaaagagaagcatcaatgt
tcgctgattgacgcgaaagataccttcagtgcggactatcagaaggagcctggcgtgcaa
gggccgctaaaagtggggaactcgctggtggatgcgtttaccctacaatattacgaagga
tttccattggatcaggtcgcctggggcgagatcaagaccgatcggcagtggaaagtgctg
tcaaaactgaaaaacggctaccaggacagtctgtttacttcaccagccgtggcgcgcaac
gtcgcggcgccgctggtaaggtatattgataaggcgttagtcgttgatcgtgccagcgcg
tcgaagatgactgtcctggtaggccatgattccaatatcgcttcactgttgacggcgctg
gattttaaaccctatcaattgcatgaccagtatgagagaacgccaattggtgggcagata
gtctttcaacgctggcatgaccgtaaggctaaccgcgagttgatgaaaattgagtatgtc
tatcagagcgcccggcagctacgtaacgcggaagtgttaacgctcaagtcgcccgcgcaa
cgggtaacgctggagctgaaaggatgtccggtggatgcgaacggcttctgtccgcttgat
aaattcgatgccgtcatggaagcggcggcaaaatag

DBGET integrated database retrieval system