KEGG   Salmonella bongori serovar 48 z41 --: N643_05485Help
Entry
N643_05485        CDS       T03249                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00450  Selenocompound metabolism
sbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    N643_05485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbv03016]
    N643_05485
Enzymes [BR:sbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     N643_05485
Transfer RNA biogenesis [BR:sbv03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    N643_05485
 Prokaryotic Type
    N643_05485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AID24699
Position
1183076..1184119
Genome map
AA seq 347 aa AA seqDB search
MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPVNTLSPDIARE
VTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEIMCRMNSAGTAFANIDGVKAMTDVTGFGLLGHLSEM
CQGAGVQAQLNYQNIPKLPGVEEYIALGAVPGGTERNFASYGHLIGDMPREVRSLLCDPQ
TSGGLLLAVTPDAEDEVKATAAEFGIDLTAIGELVEAHSGRPMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaagccattcgtttaacgcaatacagccacggagccggttgtggttgtaaa
atttcccctaaagtgctggaaactatcctgcatagcgagcaggcgaagttcgtcgatccg
aatctgctggtggggaatgaaacccgtgatgacgcagcggtttacgatttaggtaatggc
accagtattatcagcactaccgacttctttatgccgatagtcgataatccgtttgatttt
ggccgcattgcagccacaaacgccatcagcgatatttttgcgatgggcggcaagccgatt
atggccatcgcgatcctcggctggcctgtcaacaccctgtcgcccgatattgcgcgtgaa
gtgaccgaggggggacgttttgcctgccgtcaggctggtatcgccctggcaggcggacac
tctattgatgcgcctgaacccatctttggtctcgcagtcaccggcgtggtgccgaccgaa
cgggtgaagaaaaacagtaccgcgcaggccggctgcaaacttttcctgacgaaaccgttg
gggattggcgtattgactaccgccgagaaaaaatcgctgctcaagcctgaacatcaggga
ctggccacggaaatcatgtgtcggatgaatagtgccggcaccgcatttgccaatatcgac
ggtgtcaaagccatgactgacgtcaccggctttggtctgctggggcatttaagcgaaatg
tgccagggcgcaggcgtgcaggcgcagcttaactatcagaacatccctaaactgcctggc
gtggaagagtatattgctttgggcgccgtaccaggcggcacagagcgtaactttgccagc
tacggtcatctgataggcgatatgccgcgtgaagttcgtagcctgctgtgcgacccgcaa
acgtctggcggcctgctgctggcagtcacgccagacgccgaagacgaagtaaaagccacc
gcggcggaatttggtatcgatctgaccgcgattggcgaactggtcgaagcccatagtggt
cgccctatggttgagatccgttaa

DBGET integrated database retrieval system