KEGG   Salmonella bongori serovar 48 z41 --: N643_10470Help
Entry
N643_10470        CDS       T03249                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    N643_10470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbv02000]
    N643_10470
Transporters [BR:sbv02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    N643_10470
   Histidine transporter
    N643_10470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AID25432
Position
complement(2229614..2230300)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQSRVTGLIFEGYTTLIRGIP
DLVLMLLIFYGLQIALNAVTDSLGLNQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTRGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacgggttttcaggcgtaattttacagggcgctatcgtcacgctggaactggcg
ctcagttccgtagtgctggctgtgcttattggccttgtcggcgcgggggcgaagctttcg
caaagccgggtgacggggctcatctttgaagggtataccactctgattcgtgggataccg
gatctggtattaatgctgctgatattttacggattgcaaattgcgcttaacgcagtaact
gattcgttgggtcttaaccagattgatatagatcctatggtggccggtattattactctc
ggtttcatctacggggcctattttacggaaactttccgcggcgcctttatggcggtgccg
aaaggccatattgaagcggcgacagcatttggttttacccgcgggcaaacgttccggcgg
attatgtttccggcaatgatgcgttacgccctgccggggatcggcaataactggcaagtg
atactcaaagcgacggcactggtgtcgctgctgggcctggaagatgttgtcaaggccacg
cagcttgccggtaaaagtacctgggagcctttctatttcgctgttgtgtgcggactcatc
tacctggtatttaccaccgtctccaatggcgttttgctcttacttgagcgtcgttattcc
gtgggcgtgaagagggccgatctgtga

DBGET integrated database retrieval system