KEGG   Salmonella bongori serovar 48 z41 --: N643_12865Help
Entry
N643_12865        CDS       T03249                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00071  Fatty acid degradation
sbv00280  Valine, leucine and isoleucine degradation
sbv00310  Lysine degradation
sbv00362  Benzoate degradation
sbv00380  Tryptophan metabolism
sbv00620  Pyruvate metabolism
sbv00630  Glyoxylate and dicarboxylate metabolism
sbv00640  Propanoate metabolism
sbv00650  Butanoate metabolism
sbv00900  Terpenoid backbone biosynthesis
sbv01100  Metabolic pathways
sbv01110  Biosynthesis of secondary metabolites
sbv01120  Microbial metabolism in diverse environments
sbv01130  Biosynthesis of antibiotics
sbv01200  Carbon metabolism
sbv01212  Fatty acid metabolism
sbv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N643_12865
   00630 Glyoxylate and dicarboxylate metabolism
    N643_12865
   00640 Propanoate metabolism
    N643_12865
   00650 Butanoate metabolism
    N643_12865
  Lipid metabolism
   00071 Fatty acid degradation
    N643_12865
   00072 Synthesis and degradation of ketone bodies
    N643_12865
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N643_12865
   00310 Lysine degradation
    N643_12865
   00380 Tryptophan metabolism
    N643_12865
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N643_12865
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N643_12865
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N643_12865
Enzymes [BR:sbv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N643_12865
Exosome [BR:sbv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N643_12865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AID25803
Position
complement(2754362..2755570)
Genome map
AA seq 402 aa AA seqDB search
MAVSFCAEVVMKEVVIVAALRTPIGCFQGTLARHSAVELGSMVVKALIERSGVDVNAIDE
VILGQVLTAGAGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIV
IAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGI
SRELQDAWALSSQQKARAAIDTGRFKDEIVPVITQRNGQIAIVDTDEQPRADTSAEGLAQ
LHPAFDSFGSVTAGNASSINDGAAAVMMMSEAKAMELGLPILARIRAFASVGVDPALMGI
APVYATRRCLERAGWQLADVDLIEANEAFAAQAISVGKMLEWDERRVNVNGGAIALGHPI
GASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTVERD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcattttgcgctgaggtggtaatgaaagaggttgtgattgtggcggcactg
cggacgcccatcggctgttttcagggaacgctggcccgtcattccgccgtcgagctgggg
agcatggtcgtaaaagcgttgattgagcgcagtggcgtggatgttaatgctatcgatgag
gtcatccttggtcaggtgctgaccgccggcgccgggcagaacccggcacgccagtccgct
atcaagggggggctgcctaataccgtttccgctattaccattaatgacgtttgtggttcc
ggtttaaaagcattgcaccttgcgacgcaggctattcagtgcggtgaggcagacattgtt
atcgcgggtgggcaggaaaatatgagccgtgcgccgcatgtcctcaatgacagccgtact
ggcgcgctacctgatgctgacaatctggtggatagcctggtacatgacggcttatgggac
gcttttaacgattatcacattggcgtaacggcagaaaatctggcgcgggaatatggtatc
agccgtgaattacaggatgcctgggcgctcagttcgcagcaaaaggccagggcggcgatc
gataccggacgttttaaagatgagattgtccctgtcatcacgcagcgtaacgggcagatc
gcgattgtcgataccgatgaacaaccgcgcgctgacaccagtgcggaagggttagctcaa
ttgcatccggcatttgatagttttggttcggtaacggcgggtaatgcctcatcaattaat
gacggcgccgccgccgtgatgatgatgagcgaggcgaaagccatggaattggggttaccg
atactggcgcgcatccgcgcgtttgccagtgtcggcgtcgatccggcgctgatgggtatt
gctccggtatacgccacccggcgttgcctggagcgggcaggatggcaactggcggatgtt
gatcttattgaagccaacgaagcgtttgccgcccaggcgatatcggtcggaaaaatgctg
gaatgggatgagcgacgggtgaatgttaacggtggtgcaatagccctggggcatcccatt
ggtgcttccggttgccgaattcttgtttcactggtgcatgaaatggttaaacgcgatgcg
cgaaaagggctggcaacgctttgtatcggcggtggtcagggcgtcgctttaacggttgag
cgtgactga

DBGET integrated database retrieval system