KEGG   Salmonella bongori serovar 48 z41 --: N643_18130Help
Entry
N643_18130        CDS       T03249                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sbv  Salmonella bongori serovar 48:z41:--
Pathway
sbv00561  Glycerolipid metabolism
sbv00640  Propanoate metabolism
sbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    N643_18130 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    N643_18130 (gldA)
Enzymes [BR:sbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     N643_18130 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AID26572
Position
complement(3849397..3850500)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGANVIARLGDYLKPMANNWLVVGDKFVLGFAEETLRKSLTDAGLSVE
IAPFGGECSQNEIDRLRAVAEKSQCGAVLGIGGGKTLDTAKALAHFMNVPVAIVPTIAST
DAPCSALSVIYTDAGEFDRYLMLPHNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLIEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAIHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALC
HSVGLPITLAQLDIKQDIPAKMRTVAEASCAEDETIHNMPGGATPDEVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattattcagtcaccaggtaagtatattcagggtgcaaacgtcatcgcgcgt
cttggcgattatttaaaaccaatggcgaacaactggctggttgtgggcgataaattcgtg
ctgggatttgccgaagaaacgctacgcaaaagcctgacggatgccggtttgtcagtagaa
atcgccccgtttggcggcgaatgttcgcaaaatgagatcgacaggctgcgcgccgtcgcc
gagaaaagtcagtgtggcgccgtactgggtatcggcggcggtaaaacgctggataccgcc
aaagcgctggcgcactttatgaacgtcccggtcgctatcgtgccgaccatcgcctctacc
gacgcgccgtgcagcgcgctctcggtgatttataccgatgccggtgagtttgatcgttat
ctgatgctgccgcataacccgaatatggtcattgtcgataccaaaattgtcgcgggcgca
ccggcacgtctgctggcagccggtatcggcgatgcgctggcaacctggtttgaagcgcga
gcctgctcacgtagcggcgcaaccacaatggcgggcggcaagtgtacacaagccgcactg
gcgctggcggagctatgctataacacgcttattgaagagggcgaaaaagccatgttggcc
gccgaacagcacgtcgtcacgccagcgctggaacgcgtcatcgaagctaatacttatctt
agcggggttggttttgaaagcggcggtctggccgcagcgcacgccattcataacggttta
acggcgattccggatgcgcaccactattatcacggtgagaaggtcgctttcggtacgctg
acgcaactggtgctggaaaacgcgccggtcgaagagatcgaaaccgttgctgcgctgtgc
cattccgttggcctgccgattacgctggcgcaactggatattaaacaggatatcccggca
aaaatgcgcaccgtcgcggaagcctcctgcgcagaagatgaaacaattcataacatgcca
ggcggcgccacgccggatgaagtgtacgccgcgctgctggtcgccgaccagtacggtcaa
cgcttcttgcaggaatgggaataa

DBGET integrated database retrieval system